KEGG   Acetobacter pasteurianus 386B: APA386B_789Help
Entry
APA386B_789       CDS       T02786                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apk  Acetobacter pasteurianus 386B
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apk01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810955..812082
Genome map
AA seq 375 aa AA seqDB search
MTGYTSPSLTNAKRLVVKIGSALVVDPEKQAPRQEWLASVAADIAYLRKQGTAVTIVSSG
AIALARHTLGLAGGALRLAEKQAAAAVGQISLAQAWSNALSAHGLIAAQLLLTPEDTEDR
KRYLNARATLNTLLEMGCVPVINENDTVATAEIRFGDNDRLAARVAQMTDSDQLVLLSDI
DGLYTADPRTNPDAQHLPVIETLTPEIEAMGGEPPPGYSSGGMRTKLLAAGIATRSGCAM
AIALGKTPHPLRSLLDGGRCSWFLPQDCAHTARKQWIAGSLTPAGEIMVDDGAVTALQQG
KSLLPAGVLGVKGDFSQGDLVEIINTDGIVLAHGLAAYDADDARRIAGHRSTELTDILGW
HGRDEIIHRDDLVMI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacaccagcccctcccttaccaatgccaaacggcttgttgttaaaataggt
agcgcgctggtggtggacccagaaaaacaggctcctcgtcaggaatggctggccagtgtg
gcggcagatattgcgtatctgcgcaaacagggcacggctgttactattgtatcttctggc
gctattgcacttgcccggcacacattgggtttggctggtggcgcgctccgtttggcagaa
aaacaggctgccgctgctgtagggcagatcagtctggcgcaggcatggagcaatgctctt
tcagcccacggccttattgccgcccagcttctgctgaccccggaagatacagaagaccgc
aaacgctacctgaatgcacgcgcaacgctgaataccctgctggaaatggggtgtgttccc
gtaattaacgagaacgataccgttgccacagccgaaattcgttttggcgataatgacagg
ctggcagcccgcgttgcacaaatgactgactcggaccagcttgtgctgctgtctgatatc
gatggtctctacacggctgacccacgcacaaacccggatgcacagcatctgcccgtgatt
gaaacccttaccccggaaattgaagccatggggggtgagcctcctccgggttattcttct
gggggtatgcgcaccaagctgttggctgcgggcattgctacacgctcgggctgtgccatg
gctattgccttgggtaaaacgccccacccgctccgctctttactggacggtgggcgctgc
tcatggttcttgccgcaagattgcgcccatacagcccgcaagcagtggattgcaggcagc
ctgacaccagcaggtgaaattatggtggatgatggtgccgtaaccgcattacagcagggc
aaatctcttttgccagcaggtgtgcttggggtgaaaggtgatttctctcagggtgatctg
gtagaaattatcaatacggatggcatcgtgctggctcatgggcttgccgcctatgatgca
gacgatgcccggcgcattgcgggccaccgctccaccgagcttacagatattttgggatgg
cacggacgggacgagatcatccatcgtgatgacctcgtcatgatctag

DBGET integrated database retrieval system