KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0013Help
Entry
APL_0013          CDS       T00476                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:apl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13754..15256
Genome map
AA seq 500 aa AA seqDB search
MKRLLPFLTELDAWVTELKPLKQMTLDSRQVDEGDLFVALKGHQVDGRRFIQKAIEQGAA
LVLAEADEGQDEIELDAKFAKYNLDRTACKVVLVPNLARILSEIAGAFYANPSEKLTLVG
VTGTNGKTTSAQLLAQWHNLLGGKSAVMGTIGNGLYGKVQEAANTTGSAIEVQRNLADFV
EMGADFCAMEVSSHGLAQYRAEALSYDLAVFTNLSRDHLDYHKTMEEYAQAKFRLFSELD
TKAQVLNADDEVGREWLAKLPDAVAVSTDASFSSEHKFVKATDVSFSLQGVKIAFESSWG
NGELNSRLIGAFNVNNLLTALAGLLVLGHDLPKLIETAPLLQGVAGRMECVVSQKNPQNR
PLVLVDYAHTPDALEKALQAARLHTEGELYCIFGCGGDRDAGKRPMMAAIAEELADKVIA
TDDNPRTEDNAKIMADILNGFVQVEKVQVIHDREQAIKTAIEQANEKDVILIAGKGHEDY
QIIGTTKHHFSDQETAAKYL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttacttccctttctcaccgaacttgatgcttgggtgacggaattaaaaccg
cttaagcaaatgacgttggattctcgccaagttgatgaaggcgatctgtttgtggcgtta
aaagggcatcaagtggatggtcgccgatttattcaaaaagcgattgagcaaggcgcagct
ttagtcttggcggaagcggacgaagggcaggacgaaattgagttggatgcgaaatttgca
aaatataacttagatcgcaccgcttgtaaggtggttttagtaccgaatttggctcgtatt
ttatcggaaattgccggtgcgttttatgccaatccgtctgaaaaactcactctcgtaggt
gtaaccggtaccaacggcaagaccacaagcgcgcaattacttgcccaatggcataaccta
ttaggcggaaaatcggcggtaatggggacgatcggtaacggtttatacggcaaagtacaa
gaagcggcaaataccaccggttcggcgattgaagtgcaacgtaatttagccgactttgtg
gaaatgggcgctgatttttgtgcgatggaagtttcttcgcacggcttagctcaatatcgt
gcggaagcgttaagctatgatttagcggtattcactaatttaagccgtgatcatctcgat
taccacaagacaatggaagaatatgcacaagcaaaattccgtttgtttagcgaattagat
accaaagcacaagtattaaacgctgatgatgaagtcgggcgtgaatggttggcaaaattg
ccagatgcggttgccgtcagtaccgatgcgagctttagtagcgagcataaattcgttaaa
gcgaccgatgtgagctttagcttacaaggtgtaaaaattgcgtttgaatcgagctggggc
aacggcgagttaaatagccgtttaatcggtgcatttaacgtcaataatttactcacagca
ttagccggcttattagtgcttggtcatgatttaccaaaattaattgaaactgcaccgctt
ctgcaaggggttgccggacgtatggagtgtgtcgtttcgcaaaaaaatccgcaaaataga
ccgcttgtattagtcgattacgctcatacgccggatgcgttggaaaaagccttgcaagcg
gcacgattacataccgaaggcgagctttattgtattttcggttgcggtggtgatcgtgat
gcgggcaaacgcccgatgatggcggcgattgccgaagaactggcggataaagtgattgcg
accgatgacaatccgagaaccgaagataacgctaagattatggcggatattctcaacggt
ttcgttcaagtggagaaagtacaagtgatccacgatcgtgaacaagcaattaaaaccgca
attgaacaagcgaatgaaaaagatgtgattttaattgccggtaaagggcacgaagattac
caaattatcgggacgactaagcatcatttttcggatcaggaaaccgcggctaaatacctg
tag

DBGET integrated database retrieval system