KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0074Help
Entry
APL_0074          CDS       T00476                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:apl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APL_0074 (recR)
DNA repair and recombination proteins [BR:apl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     APL_0074 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      APL_0074 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 CcdA CARD
Motif
Other DBs
NCBI-ProteinID: ABN73182
UniProt: A3MYE6
Position
complement(85727..86392)
Genome map
AA seq 221 aa AA seqDB search
MDSSLYCGYPLLIFNYPFLFMQISPLLENLMEALRALPGVGPKSAQRMAYHLLQRNRSGG
INLSKALNEAMTHIGHCRSCRTFTEEDECNICKNPRRQMSGQLCVVEMPEDIQAIEQTGQ
FSGRYFVLMGHLSPLDGIGPREIGLDLLQSRLENESFHEVILATNPTIEGDATANYIAEM
CRIHNVKVTRIAHGIPVGGSLEMVDGTTLSHSFAGRRDVSL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcgctttattgcggctatccattattaattttcaactatccgtttctattt
atgcaaattagccctttactcgaaaatctgatggaagccctacgtgcattacctggtgtc
ggcccgaaatccgcgcagcgtatggcataccatttattgcaacgcaatcgttccggcggt
atcaatttatccaaagccttaaatgaagcgatgacgcatatcggtcattgccgttcttgc
cgtacttttaccgaagaagacgaatgcaatatttgtaaaaatcctcgtcgccaaatgagc
ggtcagctttgcgtagtagaaatgccggaagatattcaagcgattgaacaaaccggacag
ttttcgggacgttatttcgtattaatgggacatctttcaccgttggacggtatcggaccg
agagaaatcggcttggatttgttacaaagccgtttagaaaacgaatcttttcacgaagtt
attctagctaccaatccgactattgaaggtgatgccaccgccaactatattgcggaaatg
tgccgcattcacaacgtgaaagtaactcgaattgcgcatgggattccggtcggcggttca
ttagaaatggtggacggtacgaccctttcccactcttttgccggcagacgagatgtttcg
ttataa

DBGET integrated database retrieval system