KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0074Help
Entry
APL_0074          CDS       T00476                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APL_0074 (recR)
DNA repair and recombination proteins [BR:apl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      APL_0074 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85727..86392)
Genome map
AA seq 221 aa AA seqDB search
MDSSLYCGYPLLIFNYPFLFMQISPLLENLMEALRALPGVGPKSAQRMAYHLLQRNRSGG
INLSKALNEAMTHIGHCRSCRTFTEEDECNICKNPRRQMSGQLCVVEMPEDIQAIEQTGQ
FSGRYFVLMGHLSPLDGIGPREIGLDLLQSRLENESFHEVILATNPTIEGDATANYIAEM
CRIHNVKVTRIAHGIPVGGSLEMVDGTTLSHSFAGRRDVSL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcgctttattgcggctatccattattaattttcaactatccgtttctattt
atgcaaattagccctttactcgaaaatctgatggaagccctacgtgcattacctggtgtc
ggcccgaaatccgcgcagcgtatggcataccatttattgcaacgcaatcgttccggcggt
atcaatttatccaaagccttaaatgaagcgatgacgcatatcggtcattgccgttcttgc
cgtacttttaccgaagaagacgaatgcaatatttgtaaaaatcctcgtcgccaaatgagc
ggtcagctttgcgtagtagaaatgccggaagatattcaagcgattgaacaaaccggacag
ttttcgggacgttatttcgtattaatgggacatctttcaccgttggacggtatcggaccg
agagaaatcggcttggatttgttacaaagccgtttagaaaacgaatcttttcacgaagtt
attctagctaccaatccgactattgaaggtgatgccaccgccaactatattgcggaaatg
tgccgcattcacaacgtgaaagtaactcgaattgcgcatgggattccggtcggcggttca
ttagaaatggtggacggtacgaccctttcccactcttttgccggcagacgagatgtttcg
ttataa

DBGET integrated database retrieval system