KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0253Help
Entry
APL_0253          CDS       T00476                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APL_0253 (recD)
Enzymes [BR:apl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     APL_0253 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276157..278094
Genome map
AA seq 645 aa AA seqDB search
MLTLLYELKETNVISELDYQFAKMIDRKQQSYPYTEQQKNLAVLLAALVSFHVMQGHAAI
RLDSQASRFFFGLSNRNEEKALNDEILQKIGGITPLEWQGVLQNHIAFSSDPKQVAPMLF
QHGLLYFYRYWQAENNIANYLVKAVEFPEQIANTALDKQILEKLFEKSDEVNWQKIAVAT
AIKQKFSIISGGPGTGKTTTVAKLLAALQEKQLRSGKAMLNVALVAPTGKAAARLKESIT
LSLSVLNLNFEIPTTASTIHRLLGIRPQSDEPRYHSKNPLHIDLLVVDEASMIDLFLMEK
LMAALKPNTRLIILGDKDQLASVEAGAIMGELGAFLQQGYSRKHCDYLNQVTEYQLVPKG
KSLPICDSLCHLKKSYRFDANSGIGQLAKLVNEKQAVESWQLFAKGSADLSLIEYAHTSD
FPEKQQWIQNCVKQITDKAVELYKEYLTLVKQRYNNPTKVSVNEIFEVFQKVRFLSALRI
SELGVEQLNKRIETALAAAKLISLEQSKNYYIGKPLLITQNSPQNHIYSGDIGIILPDEN
GISRVYFDTKIDDGYLSLSLNRLPEFEPAYVMTVHKSQGSEFEHTLLITPLHFAPVMSKE
LIYTAITRAKKHFTLFGEKQVWLQAVNNNLQRQSGLKAQLMHLFS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcttttatatgagttaaaagaaacgaatgtgatttccgaattggattatcaa
ttcgctaaaatgattgatcgtaaacagcaaagttatccctataccgaacaacaaaaaaac
ttggcggtattgcttgccgcattagtttcttttcacgtaatgcaaggtcatgccgctatt
cgtttggattctcaagcctcacggttttttttcggtttatcaaatcgaaatgaggaaaag
gcgcttaatgatgaaattttgcaaaaaatcggcggaatcacgccgcttgaatggcagggc
gtattacaaaatcatattgcgtttagttcggatcctaagcaagtcgcaccgatgttgttt
caacacgggttactttatttttatcgttattggcaggcggaaaacaatattgcgaattac
ttagtgaaagcggtcgaatttcccgaacaaattgccaataccgcattggataagcaaatt
ctagaaaaactatttgaaaagtcggatgaagtaaattggcaaaaaatagcggtcgctacg
gctatcaaacaaaagtttagcataatttcaggcgggccgggaaccggtaaaactacaacg
gtcgccaaattattagctgcgttgcaagaaaaacagctacgtagcggtaaagcaatgttg
aatgttgcgcttgtcgcaccgacaggaaaagcggcggcacgtttaaaagagtcaatcaca
ttaagtttaagcgtgcttaatttgaattttgaaattccaacgaccgcctcgacaattcat
cgtttgttaggaatacgtccgcaaagtgatgagcctcgttatcactcaaaaaatccgtta
catattgatcttttagtggtggatgaagcgtctatgattgatcttttcttaatggaaaaa
ttaatggcggcattaaaaccgaatacccgattaattattttaggcgataaagatcagctt
gcgtcggttgaagccggagcgattatgggagaactcggagcgtttcttcaacagggatat
agccggaaacattgcgattatttgaatcaagttaccgagtatcaattagttccgaaagga
aaatcattacctatttgtgattcgttatgtcatttgaaaaaaagttatcgttttgacgct
aattccggaatcggtcagttggcgaaactggttaatgaaaagcaagcggttgaatcttgg
caactttttgcaaaaggctcagcggatttatctttgatcgaatatgcacacacttcggat
ttcccggaaaaacagcagtggattcaaaattgcgtgaaacaaataacagataaagcggtc
gagctttataaggaatatctaacgcttgttaaacaacgttacaataatccgacgaaagtg
tcggtaaatgaaattttcgaggtttttcaaaaagtaagattcttatccgcattgcgtata
agtgaattgggcgtagagcaattaaataaaaggatagaaacggcattagcggcggcaaaa
ctgatttctttagaacaaagtaaaaattactatatcggtaaaccgttactcattacacag
aactcgccgcaaaatcatatttatagcggcgatatagggattatcttaccggatgagaac
ggaatatcgagagtttattttgatacgaaaattgacgatggatatttaagtctttctctg
aatagacttcccgaatttgaaccggcttatgtaatgacagttcataagtcgcaaggttct
gaattcgaacataccttactgataacgccattgcactttgcaccggttatgagtaaagaa
ttaatttatacggcgattacccgagctaaaaagcattttactttattcggagaaaaacaa
gtttggttacaggcggtgaataataatcttcagcgtcaaagcggattaaaagcacaatta
atgcacttgttcagttaa

DBGET integrated database retrieval system