KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0256Help
Entry
APL_0256          CDS       T00476                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00230  Purine metabolism
apl01100  Metabolic pathways
Module
apl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    APL_0256 (gmk)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     APL_0256 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase MMR_HSR1 ABC_tran AAA_33 AAA_22 AAA_29 AAA_23 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ABN73364
UniProt: A3MYX8
Position
286426..287046
Genome map
AA seq 206 aa AA seqDB search
MLGNLYILSAPSGAGKSSLINALLADLPRSEVQLSVSHTTRNPRPGEEHAVHYYFTHHAE
FESLIEQGHFLEWAEVFGNYYGTSLPMIEKSLENGIDVFLDIDWQGARQIRNKVPNVKTI
FILPPSREELEKRLIGRGQDSAETIGKRMAEAVSEMSHYNEFDYVIVNDDFQTALSELKS
ILTSERLKQASQAVRYEKLIRQLLSK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtaatctttacattctttccgcaccaagcggtgccggtaaatcctcattgatt
aatgcgttattagcggatttacctcgttcggaagttcaactttctgtttcgcatactacg
cgtaatcctcgtccaggagaggaacatgcggtacattattattttactcatcatgcggaa
ttcgaatcgttaatcgagcaagggcattttttagaatgggctgaagtattcggtaattat
tacggtacatctttgccgatgatagaaaagagtttagagaacggcattgatgtcttttta
gatatcgactggcaaggtgcacgtcaaattcgtaataaagttccgaatgtaaagactatt
tttattttaccgccttctcgtgaggaattggaaaaacgtttaatcggaagaggtcaagat
tcggcagaaacaatcggtaaaagaatggccgaggccgtatcggaaatgtctcattataat
gagtttgactatgtgatcgtaaatgatgatttccaaaccgcattaagtgagttaaaaagt
attttaacttccgagcgtttaaaacaagcttctcaagcggttcgatatgaaaaattaatt
cgccaattactttcgaaataa

DBGET integrated database retrieval system