KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0269Help
Entry
APL_0269          CDS       T00476                                 

Gene name
thrCA
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APL_0269 (thrCA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APL_0269 (thrCA)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APL_0269 (thrCA)
Enzymes [BR:apl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APL_0269 (thrCA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297556..298650
Genome map
AA seq 364 aa AA seqDB search
MKFICNQCQQIAPVSTRQAKCQCGGLWTLDYQPPKFDLNEIDQYEWNLFRYRKFIALQDE
SWRDISLGEGMTPIVRFDENVLLKMDYFMPTLSFKDRGAAVLISHCKSIGVDSVVQDSGG
NAGNSVAAYCAKAGIQCEIFVPEGTSPKKINMIEAHGAKANVIKGSRDHCADVCRAKVEN
EGVYYANHVYNPFFYEGTKTYIYETFEQLGRIPKHIVVPVGNGTLFIGVIKGLEHLLESG
VIDEMPTIIALQSEYCDPLLQAVKKGQKFAEQVEIKPTIAEGIAIGQPMRASEILAYAEK
YAIRFVHAPEDKILAARNALAKKGIYCEHTTAANYAAYLHYCELYGAVEECLITICGAGL
KSDH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatctgtaatcaatgccaacaaattgcgccggtatctactcgccaagcaaaa
tgtcaatgcggaggcttatggacactggattatcaaccgcctaaattcgatctcaacgag
attgatcagtatgagtggaacttatttcgttatcgaaaatttattgctttgcaagatgaa
agttggcgtgatatttccttgggtgaggggatgacgccgatagtccgctttgatgaaaat
gtattattaaaaatggattattttatgccaacgctttcctttaaagaccgtggtgcggcg
gtacttatcagtcattgtaagtcgattggtgttgattcagtggtacaagatagtggtggt
aatgcaggcaatagtgttgcagcctattgtgctaaagcgggtattcaatgtgaaattttt
gtaccggaaggaacatcgccgaaaaaaattaatatgattgaggcgcatggtgctaaagct
aatgtgattaaaggtagccgtgatcattgtgcagatgtatgtcgtgctaaagttgaaaat
gagggcgtttattatgccaatcacgtgtataaccccttcttctacgaaggtacgaaaacc
tatatttatgaaacgtttgaacagctcgggcggattccaaaacatattgtcgttccggtt
ggaaacggtactttgtttattggtgtcattaaaggactagaacatttgttggaaagtggc
gttattgatgaaatgccaacgattattgcattacaaagcgaatattgtgatccattattg
caagcggtcaaaaaagggcaaaaatttgcagaacaggttgagattaagccgactatcgcc
gaaggtattgccattgggcagcctatgcgagcaagtgaaattttagcttatgcggaaaaa
tatgcgattcgttttgttcatgctccggaagataaaattcttgcggcacgaaacgcttta
gccaaaaaagggatttattgtgaacacactaccgcagctaactatgcggcttatcttcac
tactgtgagctatatggtgcagtagaagaatgcttaattacgatatgtggtgccggactg
aaatcagaccattaa

DBGET integrated database retrieval system