KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0283Help
Entry
APL_0283          CDS       T00476                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APL_0283 (ruvA)
Enzymes [BR:apl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     APL_0283 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313035..313640
Genome map
AA seq 201 aa AA seqDB search
MIGRLHGKIIEKQPPEMVIDVQGVGYEVLLPMTSFYSLPQVGEEATIFTHLVVREDAHLL
FGFAQKQDRTLFRELIKTNGVGPKLALAILSAMSVSQFANAVENEELAKLTKIPGIGRKT
AERLLVELKGKFKGVAQSDFFEEHSVETIVATHSHDPADEARDALVALGYKLADAEKMIK
KVNKAGATSEQLIREALKASL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaagattacacggtaaaattattgaaaaacaaccgcctgaaatggtaattgat
gtccaaggtgtcgggtatgaagtgctattgccgatgacgagcttttacagcttgccgcaa
gtaggtgaagaagccactatttttacgcatttagtcgtacgtgaagatgcacatttatta
tttggttttgcacaaaagcaagatagaactttatttcgtgaattgattaaaaccaacggt
gtagggcctaaattagcccttgcgattttatcagcaatgtcagtttcacaatttgccaat
gctgttgaaaatgaagaacttgccaaattaactaaaattccgggcattgggcgtaagaca
gccgagcgtttattagtagaactcaaaggcaaattcaaaggtgtggcacaaagtgatttc
tttgaagagcattcggttgaaacgattgttgcaacacattcgcacgatccggcagatgaa
gcccgtgatgctttagtagcgttaggctataaactcgctgatgctgagaagatgattaag
aaagtgaataaagcgggtgcaaccagcgaacaattaattcgtgaagcattaaaagcctct
ctttaa

DBGET integrated database retrieval system