KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0346Help
Entry
APL_0346          CDS       T00476                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:apl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383383..385716
Genome map
AA seq 777 aa AA seqDB search
MKTYTYSKQDLSFIEQLSQAYCKDPFSYLGLHQAGDVSVIRVFLPEATTVKILSAVGQIL
SEALKIDDSGLFVAQLAQQYSSLNYRLRVGYSLAEIDLEDPYRFTSSLLPMDNWLLAEGT
HLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWDGRVNPMRFHAESGIWDI
FLPNVEKGALYKFEILDSNGNIRLKSDPYAFASQFRPDTASVVTGLPEKIEVDAKLRHAN
DPDQPISIYEVHLGSWRRHLENNYWLNYEEIANELIPYVKDMGFTHIELLPITEYPFDGS
WGYQPTGLYSPTSRFGSPEDLRTLIRKAHEAGINVILDWVVGHFPTDSHGLTEFDGSHLY
EHQDPREGYHQDWNTLIFNYGRHEVFNYLSSNALYWTERFGIDGLRVDAVSSMIYRDYSR
KDGEWIPNQYGGRENLEALDFLRRTNRMLKKEGHGAVVIAEESTSFAGITHSPEENGVGF
DYKWNMGWMNDTLRYMSLDPIYRQYHHDWMTFGMMYQYSEKFVLPLSHDEVVHGKCSILG
KMSGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYNESLDWFLLGEQGGGWH
KGVLNWVRDLNRTYQKYPALYQLDYDPAGFEWLVVDDWQQSVFAFERKAKNGESVIVVSN
FTPVVRHNYRIGVRQDGTYTEILNSDAAYYEGSNVGNYGEIECEAIESHGKPFSIELSIP
PLSTIFIACQPKPKEAVEAEQDIVKMAEVAMQKALKPTKKTVSVKAKAHKKAHKNKK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatatacgtattctaaacaagatttatcttttattgagcaactttctcaagcg
tattgtaaagatcctttctcttatctcggcttacatcaagcgggtgatgtgagcgtaatt
cgtgtttttctaccggaagcaacgacggttaaaattctgagtgcagtcggtcaaatactt
tccgaagctttgaaaatagacgactcaggcttgtttgtagcgcaattggcgcagcagtat
tcttccttaaattatcgtttaagagtcggttattctttagcggaaatcgaccttgaagat
ccctatcgttttacttcttcgcttctaccgatggataactggttattggcggaaggaact
caccttcgtccatacgaaatcttaggtgcgcatttgaaaacgcaagaaggcgtttccggc
gtacatttttccgtttgggcgccgaatgcccgtcgtgtatcggttgtcggcgatttcaac
tattgggacgggcgagtaaacccgatgcgttttcatgcggaaagcggcatttgggatatt
ttcctacctaatgttgagaaaggtgcattatataaattcgaaattttagatagcaacggt
aacattcgtttgaaatccgacccttatgcgttcgcatcgcaattcagaccggatacggca
tccgtagtaacgggtttaccggaaaaaatagaagtggatgcgaaactacgtcatgcgaat
gatcccgaccagccgatttcaatttatgaagtgcatctcggttcgtggcgtcgtcacctt
gaaaataattattggctgaattatgaagaaattgccaacgaattaattccttatgttaaa
gatatggggttcactcatatcgaattgttaccgattaccgaatatccgttcgacggttct
tggggttatcaaccgaccggactttattctccgaccagccgattcggttcgccggaggat
ttacgtaccttgattcgtaaagcgcatgaagcgggtattaatgtgattcttgactgggta
gtcgggcatttcccgaccgattcgcacggtttaaccgagtttgacggctcgcatttatat
gaacatcaagatccgcgagaaggttatcatcaagattggaataccttaatttttaattac
ggtcgtcacgaggtgtttaattatctttccagtaacgccttatattggacggaacgattc
ggtatcgacggtttacgtgtcgatgcggtttcttccatgatttaccgcgattattctcgt
aaagacggcgagtggattccgaatcaatacggcggacgagaaaatttagaagcgcttgat
ttccttcgtagaaccaatcgtatgttgaaaaaagaaggacacggagcggttgtgattgcg
gaggaatccacttcatttgccggtattacgcatagtccggaggaaaacggggtcggtttc
gactataaatggaatatgggctggatgaacgataccttacgttatatgtcgctcgatccg
atttatcgtcaatatcatcacgattggatgaccttcgggatgatgtatcaatatagcgaa
aaattcgtattaccgctttcacacgatgaagtggtgcatggcaaatgttccattctcgga
aaaatgtccggcgattgttggcaaaaatttgcgaacttaagagcctattacggttatatg
tggggctatccgggtaaaaaattactgtttatgggtaatgaattcgcccaaggtcgtgaa
tggaattacaacgaaagcctcgattggttcctgttaggcgaacaaggcggcggttggcat
aaaggcgtgctgaattgggtgagagatttgaaccgtacttaccaaaaatatccggcgctt
tatcaattggattacgatcctgccggttttgaatggttagtagtcgatgactggcaacaa
tcggtatttgcttttgaacgtaaagccaaaaacggcgagagtgtgatcgtagtcagtaac
tttacgccggtcgttcgccataattatcgtataggcgtgcgtcaagacggcacttatact
gaaatcctcaattcggatgcggcttactatgaaggaagtaacgtaggcaattacggcgag
attgaatgcgaagcaatcgaatcgcacggtaaaccgttctctattgaactttcgattccg
ccgttatcaaccatttttattgcttgtcagcctaagcctaaagaagcggttgaagccgaa
caagatattgtgaaaatggcggaagttgcgatgcaaaaagcattaaaacccactaaaaaa
acggtaagcgtaaaagctaaagcacataaaaaagctcataaaaataagaagtaa

DBGET integrated database retrieval system