KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0375Help
Entry
APL_0375          CDS       T00476                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424031..425542
Genome map
AA seq 503 aa AA seqDB search
MTKEYIIALDQGTTSSRAVLLDKNANIVEVSQREFTQIYPQVGWVEHNPMEIWATQSSTL
NEVVAKAGITSDKIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADICAKLKEDGH
EAYIRKTTGLVVDPYFSGTKVKWILDNVEGAREKAELGELLFGTVDTWLVWKLTQGRVHV
TDYTNASRTMMFNIHTKQWDDKMLELLNIPRSMLPEVRNSSEVYGETNIGGKGGVRIPVA
GMAGDQQAALYGHLCVEAGQAKNTYGTGCFMLMNTGNEAVESKNGLLTTIACNAKGEPCY
ALEGSIFMGGASIQWLRDELKIVHDSKDSEYFATKEDSTNGVYVVPAFTGLGAPYWDPYA
RGAILGLSRGANRNHIVRATLESIAYQTRDVLDAMQSDSGKHLATLRVDGGAVANNFLMQ
FQADILNANVERPVVREVTALGAAYLAGLAVGFWKDLQELRGKASIERTFVPDGDEAKRT
RRYKGWKKAVKRALEWAKEDAEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaatacattattgcgttagaccaaggtacgacaagctctcgtgcggtgtta
ctcgacaaaaacgccaatatcgtagaggtttctcaacgtgaatttacccaaatttatccg
caagtcggttgggtggaacataatccgatggaaatttgggcgacgcaaagttcgacatta
aatgaagtggtggcaaaagcgggcattacttccgataaaattgcggcaatcggtattacc
aaccaacgtgaaaccacgattgtttgggaaaaagaaaccggtaaaccggtttacaatgcg
attgtatggcaatgccgtcgtacggcggatatttgtgcgaaattaaaagaagacgggcat
gaagcttatattcgtaaaacgaccggtttagtggtggacccgtatttctccggtacgaaa
gtaaaatggattttagataatgttgaaggcgcaagagaaaaagccgagctcggcgagctg
ttattcggtacggtagatacttggttggtttggaaattaacccaaggtcgcgtgcacgtt
accgattacacaaacgcttcccgtactatgatgttcaatattcataccaaacaatgggac
gataaaatgttggaattattaaatattccgcgttctatgttaccggaagtaagaaattca
tcggaagtttacggcgaaaccaatatcggcggtaaaggcggcgtacgtattccggtagcc
ggtatggcgggcgaccaacaagcggcgctttacggtcatttatgcgtagaagccggtcag
gcgaaaaatacttacggtaccggttgctttatgttgatgaataccggtaatgaagcggtc
gaatcgaaaaacggtttgctgactaccatcgcatgtaacgcaaaaggcgaaccgtgctat
gcgttggaaggttcgatttttatgggcggtgcttcgattcagtggttacgtgacgaactt
aaaatcgtacatgacagtaaagactccgaatattttgcaacaaaagaagacagcacaaac
ggtgtgtatgtcgtaccggcgtttaccggcttaggcgcgccgtattgggatccgtatgct
cgaggtgcgattttaggactttctcgcggtgcaaaccgtaaccatatcgtacgtgcgaca
ttagagtctatcgcatatcaaacccgtgacgtattggatgcgatgcaatcggatagcggt
aaacatcttgcgactttacgtgtggacggcggtgcggttgccaataacttcttaatgcaa
ttccaagcggatattctcaatgctaacgtagaacgtccggtcgtgcgtgaagttaccgct
ttaggtgcggcatatcttgccggtcttgctgtaggattctggaaagatttgcaagaatta
cgcggtaaagcgtcgattgagcgtacctttgttccggatggcgacgaagcaaaacgtacc
agacgttataaaggttggaaaaaagcggttaaacgtgcgttagaatgggcaaaagaagac
gcagaggaataa

DBGET integrated database retrieval system