KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0454Help
Entry
APL_0454          CDS       T00476                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:apl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apl00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:apl00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(522560..523789)
Genome map
AA seq 409 aa AA seqDB search
MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS
QEQGATVTSKQLLGKISTVQAGDFTQETIKQTNEATPADRKSAAIEYDHSDADSQGPAIR
RLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAMASEHNTVSTVAYSARSE
KRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMADIE
KTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPV
AVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattttaactcccgtgctacccgaatccgtcgcggatgctaccgttgcg
acttggcacaaaaaagtaggcgatacggttaaacgtgacgaagtacttgttgaaattgaa
acggataaagtcgttttagaagtgccggcaccgaatgacggcgtattagcggaaatcagc
caagagcaaggcgcaaccgttacttctaaacagttacttgggaaaatctcaaccgttcaa
gcgggagattttacgcaagaaactatcaaacaaactaacgaagcgactcccgccgatcgt
aaatccgccgccatcgaatatgatcactcggatgccgactctcaaggtccggcaattcgt
cgtttattagcggaacataatatcgaagcgcatttagtcaaaggtaccggtgtcggcggt
cgtattacccgtgaagatatcgaacactatcttgcacaacgtcaggttcaagaaaccaaa
caagcgatggcaagcgaacacaatacggtaagtaccgtagcttactccgctcgtagcgaa
aaacgcgtgccgatgacacgtttgcgtaaacgtattgccgaacgtctgttagaagcgaaa
aacactactgcaatgctgactaccttcaacgaagtggatatgcagccgattatgagctta
cgtaaaacttacggtgagaaatttgaaaaacaacacggcgtgcgtttaggctttatgtca
ttctatattaaagcggtggtagaagcgttaaaacgttatccggaaatcaatgcttcgatt
gacggcgatgatgtggtatatcacaactacttcgatattagtattgcggtatccactccg
cgcggattagtcacgccggtgattcgtaactgcgataaattatcgatggcggatattgag
aaaaccattaaagcacttgccgaaaaaggacgtgacggtaaactaaccgtagaagaccta
accggcggtaactttaccattactaacggcggcgtattcggttcgttaatgtccactccg
attatcaatccgccgcaaagtgcgattttaggtatgcatgcgattaaagatcgccctgtc
gcagtaaacggtcaagtggtgattcgtccaatgatgtatcttgccttgtcttatgaccac
cgcttaattgatggacgtgaatctgttggtttcttagttgcggtcaaagatttattagaa
gacccgacccgtttactacttgaaatctaa

DBGET integrated database retrieval system