KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0469Help
Entry
APL_0469          CDS       T00476                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:apl00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:apl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
540457..541647
Genome map
AA seq 396 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEEAFVAAQNDPLFQAEFTDLLKNYAGRPTAL
TLCRNLTKGSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDLPCVIYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWAA
NYETTHYLIGTAAGPHPFPTMVREFQKMIGEETKRQILEKENRLPDAVIAAVGGGSNAIG
MFADFIEEKSVQLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQTKDGQIEESYS
ISAGLDFPSVGPQHAYLNSIGRAEYVSITDQEALDAFQALAQHEGIIPALESSHALAYAL
KLIAQNPDKEQLLVVNLSGRGDKDIFTVDKILNGGN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaatccttatttcggcgaatttggcggaatgtatgttccggaa
attctcgtaccggtcttaaaacaactcgaagaggcatttgttgctgcgcaaaatgatccg
cttttccaagcggaatttaccgacttactgaaaaactacgccggtcgtccgaccgcatta
acgctttgccgtaatctcaccaaaggaagtaaaaccaaactttatcttaaacgtgaagat
ctgttacatggcggcgcacataaaaccaaccaagtattaggacaagcgttattagcaaaa
cgtatgggcaaaactcgtattattgcggaaaccggtgccggacaacacggggtggcaacc
gcattggcatgtgcaatgttagatttaccttgtgtgatctatatgggtgctaaagatgtg
gaacgccaatcaccgaatgtattccgtatgcgtttgatgggtgcagaagtgattccggta
caaaaaggctcttgttcattaaaagatgcctgctgtgaagcaatgcgtgactgggcggca
aactatgaaacgacacattatttaatcggtacggcggcaggcccgcacccgttcccgacc
atggtgcgtgaatttcagaaaatgatcggcgaagaaaccaaacgacaaatattagaaaaa
gagaaccgcttaccggatgcggtgattgctgcggttggcggtggctcgaatgccatcggt
atgtttgcggattttattgaggaaaaaagcgtgcagctaatcggtgtagaaccggccggc
aaaggcattgaaaccggcgaacacggcgcaccgcttaaacatggtaccaccggcatttat
ttcggaatgaaatcgccaattatgcaaactaaggacggacaaatcgaggaatcttattcg
atctcggcaggtttagatttcccgtcagtcgggccgcaacatgcttacctcaattcaatt
ggacgagcagagtatgtctcaattaccgaccaagaagcgttagatgctttccaagcatta
gcacaacatgaaggtattattccggcattagaaagttcacatgcattggcttatgcgctg
aaattaattgcacagaatccggataaagaacaactgttagtcgtcaatctttccggtcgt
ggcgataaagatatttttaccgtagataaaattttaaatgggggaaactaa

DBGET integrated database retrieval system