KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0505Help
Entry
APL_0505          CDS       T00476                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
573751..574293
Genome map
AA seq 180 aa AA seqDB search
MSSNKWGTLGKVGGACSVLTMIAIMVTNYGDEFRTSVEGLEIIGNAEGCRREPYKCPADV
LTVGVGSTAAGGELIEANKIYSDDEIARRWKNDVVIAERCVNRLANGKQMPQSVFDSVVS
ITFNVGCGALSKSTLFRKANAQDWQGVCNELPRWVYSGGRKLKGLMLRREKEKALCLSGL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaataagtggggtacacttggcaaagttggtggcgcttgttcggtgctgacg
atgatcgctattatggttaccaattacggcgatgagtttcgcacaagcgttgaaggttta
gaaattatcgggaatgccgaaggttgccgtcgtgagccttataaatgcccagctgatgtt
ttaacggtcggtgtaggcagtacggcagcaggtggcgaacttattgaagcaaataagatt
tattctgatgatgaaattgctcgtcgctggaagaatgatgttgtgattgctgaacgttgt
gtcaatcggttagcaaacggtaagcaaatgccacaatctgtttttgactcagtagtatca
attactttcaatgtgggttgtggagcattatcaaaatctactttatttcgtaaggctaat
gcccaagactggcaaggcgtatgtaatgaattaccacgctgggtatattcaggcggtcgt
aagttgaaaggcttaatgcttcgccgagaaaaagaaaaggcattgtgtttgtcaggtttg
tag

DBGET integrated database retrieval system