KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0772Help
Entry
APL_0772          CDS       T00476                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00010  Glycolysis / Gluconeogenesis
apl00020  Citrate cycle (TCA cycle)
apl00620  Pyruvate metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01130  Biosynthesis of antibiotics
apl01200  Carbon metabolism
Module
apl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_0772 (aceF)
   00020 Citrate cycle (TCA cycle)
    APL_0772 (aceF)
   00620 Pyruvate metabolism
    APL_0772 (aceF)
Enzymes [BR:apl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APL_0772 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABN73870
UniProt: A3N0D4
Position
complement(885474..887372)
Genome map
AA seq 632 aa AA seqDB search
MSKQINVPDIGSDEVSVTEVMVKAGDTITVDQSIINVEGDKASMEVPAPEAGVVKEVLVK
VGDKVTTGSPMLVLEAAESAPALVAEAPVQAVAPVATASAVVEVNVPDIGSDEVNVTEIM
VKVGDSVEVDQSIINVEGDKASMEVPAPIAGVVKEILINVGDKVTTGKLIMKFETVSAAP
AAEEAPAQAAAPVATASAIKEVNVPDIGGDEVNVTEIMVNVGDTVSEEQSLITVEGDKAS
MEVPAPFAGVVKEILVKSGDKVSTGSLIMKFEVAGAAPAAAPAPAVQAAAPAPAAQPAAQ
PAQSGNVSGLSQDVVAAAGAYAHATPVIRRLAREFGVNLDKVKGSGRKGRIVKEDIQTYV
KTAVQVFEKQGGTAAAATGAANGAGLGLLPWPKVDFSKFGEVEEVELSRINKISGANLHR
NWVMIPHVTHFDRTDITDLEAFRKEQNKLAEKQKLDVKITPVVFIMKAVAKALEAFPRFN
SSISEDAQRLTLKKYINIGVAVDTPNGLVVPVFKNVNKKGIVELSRELMEVSKKARDGKL
TASDMQGGCFTISSIGGLGTTHFTPIVNAPEVAILGVSKSEMAPVWNGKEFEPRLMLPLA
LSFDHRVIDGADGARFLTYINGVLADIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattaatgtgccagacatcggttcggatgaagttagcgtaaccgaagtc
atggtaaaagcaggcgatacaattactgttgatcaatcgattattaatgtagaaggcgac
aaagcttcaatggaagttccggcgccggaagcaggtgttgttaaagaagttttagtaaaa
gtcggcgataaagttacaaccggttcaccaatgctagtattagaagcggcggaatctgcg
ccggctctggtagcggaagcgcctgtacaagccgtagcgcctgtggcaacagcatcagcg
gttgttgaagtgaacgtaccggatatcggttcggacgaagtaaacgtaaccgaaattatg
gttaaagttggtgattcggttgaagttgatcaatcaatcattaatgtagaaggtgataaa
gcttcaatggaagttccggcacctatcgcaggcgttgtaaaagaaattttaatcaatgta
ggcgataaagtaacaaccggcaaattaattatgaaatttgaaacggtttcagcagcgcca
gctgcagaggaagctccggcacaagctgccgcaccggttgcaacagcttcagcaatcaaa
gaagtaaatgtaccggatatcggcggtgacgaagtaaacgtaaccgaaatcatggtaaac
gttggcgatacggtatcagaagagcaatctttaattaccgttgaaggcgacaaagcttca
atggaagttccggctccgtttgcaggtgtggtaaaagaaattttagtaaaatcgggcgat
aaagtttcaaccggttcattaattatgaaatttgaagtagcaggtgcggcaccggcagca
gctcctgctcctgcagtacaagcagctgcgccagcaccagcggcacaaccggcagcgcaa
ccagctcaaagcggtaacgtttcaggtctaagtcaagatgtggtggcagcggcaggtgct
tatgcacacgcaacaccggtaattcgtcgcttagcgcgtgaattcggcgtgaacttagat
aaagtgaaaggctctggtcgtaaaggtcgtatcgttaaagaagatatccaaacatacgtt
aaaacggcagttcaagtatttgaaaaacaaggcggaacggcagcggctgcaacaggtgcg
gcgaatggcgcaggtttaggtttattaccatggccgaaagtggacttcagcaaattcggt
gaagttgaagaagtagaattaagccgtatcaataagatttcaggtgcgaacttacaccgt
aactgggtaatgattcctcacgttacacacttcgaccgtacggatatcacagatttagaa
gcattccgtaaagaacaaaataaacttgcggaaaaacaaaaattagatgtgaagatcaca
ccggttgtattcattatgaaagcggttgcgaaagcgttagaagcgttcccacgtttcaac
agttcaatctctgaagatgcacaacgtttaaccttgaaaaaatacatcaatatcggcgtg
gcggtagatactccgaacggcttagttgttcctgtatttaaaaatgtgaacaaaaaaggt
attgttgaactttctcgcgagttaatggaagtatcgaagaaagcgcgtgacggtaaatta
accgcatcggatatgcaaggcggatgtttcacgatttcaagtatcggcggtttaggtaca
acacacttcactccaatcgtgaatgcgccggaagttgcaattttaggcgtatctaagtct
gaaatggcaccggtatggaacggtaaagaattcgaaccgcgcttaatgcttccgttagcg
ttatcattcgaccaccgtgtaatcgacggtgctgacggtgcaagattcttaacctacatc
aatggtgtattagcggacatccgtcgcttagttatgtaa

DBGET integrated database retrieval system