KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0832Help
Entry
APL_0832          CDS       T00476                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APL_0832 (gpmA)
   01230 Biosynthesis of amino acids
    APL_0832 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_0832 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    APL_0832 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APL_0832 (gpmA)
Enzymes [BR:apl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     APL_0832 (gpmA)
Exosome [BR:apl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   APL_0832 (gpmA)
  Exosomal proteins of melanoma cells
   APL_0832 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966118..966801
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGQKLKAAGYEFDIAFTSVLTRA
IKTCNIVLEESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDAADPNSAHNDRRYAHLPKDVIPNAENLKITLERVLPFWEDQIAPALLSGKRVLVTA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNFVEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttattcgtcacggtttcagtgaatggaatgctaaaaacttatttaca
ggctggcgtgatgttaatttaaccgaacgtggtatcgaagaagcgaaatcggcaggtcaa
aaattaaaagccgccggttatgaattcgatatcgcattcacttcggttttaactcgtgca
attaaaacttgtaatatcgtattagaagaatctaatcaattatggattccacaagtgaaa
aactggcgtttaaacgagcgtcactacggtgcgttacaaggtttagacaaaaaagcgacc
gccgaacaatacggtgacgaacaagttcacatttggcgtcgctcttatgacatttctcca
ccggatttagatgcggcggatccgaattctgcgcataacgatcgtcgttacgcacactta
ccgaaagatgtcattccaaacgcggaaaacctcaaaatcactttagaacgtgttttaccg
ttctgggaagatcaaatcgcaccggcgttattatccggcaaacgcgtactggtaactgca
cacggtaactctcttcgtgcgttagcaaaacacatcatcggtatttctgatgctgaaatt
atggattttgaaatccctaccggtcagccgttagtattaaaattagatgataaattaaac
ttcgtagaaaaattctatttataa

DBGET integrated database retrieval system