KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0884Help
Entry
APL_0884          CDS       T00476                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APL_0884 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APL_0884 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    APL_0884 (proB)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APL_0884 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023621..1024712
Genome map
AA seq 363 aa AA seqDB search
MQKTIVIKFGTSTLTHGGKSLSRPYMLELVKQIAQLHQHHRVIVVTSGAAAAGRDYLGHP
ELPKTLAYKQMLAAVGQSQLIRTWENLFDIYGIHIGQILLTRADIDDRERFLNARDTLNA
LLEQRIIPVINENDTVATEEFKVGDNDNLSALVAILAHADQLYLLTDQEGLFDSDPRSNP
QAKLLSVVEKITPEIRQMAGGSVTGLGTGGMSTKITAADIATRSGVETVIASGSRANVLV
DLANGESIGSKFLVQSDRLEGRKQWLFAAPQVGSLVVDKGAEAALLQHKSLLPVGVSEIN
GVFSRGEVVKIFNQEGKALALGLARYNSDALIRIKGKKSKEIESLLGYEFGSVAVHIDEM
VIY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacaattgtgattaaattcggcaccagtactcttacgcacggaggaaagagt
ttaagccgtccttatatgctggaattagttaaacaaatagctcaacttcatcaacatcat
cgagtgattgtcgtcacctccggagccgcagcagccggcagagattatttaggtcatccc
gaacttcccaaaacactcgcctataaacaaatgcttgccgcagtcgggcaaagtcagcta
atccgtacttgggaaaatttattcgatatttacggcattcatatcgggcaaattttatta
acccgtgccgatattgatgatcgcgaacgttttttaaatgcgcgcgataccttaaatgcc
ttgttggagcaaagaatcattcctgtgatcaatgaaaacgatacggttgccaccgaagaa
tttaaagtcggcgataatgacaatctttccgcattggttgcgattctagcgcatgccgat
caactttatcttttaaccgaccaagaaggcttatttgattccgatccgcgttcaaatccg
caagcgaaattactgtccgtcgtggaaaaaatcacgcctgaaatccgccaaatggcgggc
ggtagcgtcaccggactcggcaccggcggtatgagtactaaaattaccgccgccgatatt
gctacgcgttccggtgtcgaaaccgttatcgcttcaggctctcgtgcaaacgtattggtc
gatttagctaacggcgaatccatcggtagtaagtttttagtacaatccgaccgcttggaa
ggtcgtaaacaatggttattcgccgctccgcaagtcggctcgcttgtggtggataaaggg
gcggaagctgcattattacaacataaatcattactgccggtcggtgtttccgagattaac
ggcgtctttagccgaggcgaagtagtgaaaatttttaaccaagaaggtaaagcgcttgct
ttggggcttgctcgttataacagcgatgcgttaattcgtattaaaggaaaaaaatcgaaa
gagattgagtctctgctcggttatgaattcggttccgtcgccgtacatattgatgagatg
gtcatttattaa

DBGET integrated database retrieval system