KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0888Help
Entry
APL_0888          CDS       T00476                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APL_0888 (fadJ)
   01212 Fatty acid metabolism
    APL_0888 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APL_0888 (fadJ)
   00650 Butanoate metabolism
    APL_0888 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    APL_0888 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    APL_0888 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APL_0888 (fadJ)
   00310 Lysine degradation
    APL_0888 (fadJ)
   00380 Tryptophan metabolism
    APL_0888 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APL_0888 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APL_0888 (fadJ)
   00281 Geraniol degradation
    APL_0888 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    APL_0888 (fadJ)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APL_0888 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APL_0888 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     APL_0888 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027658..1029775
Genome map
AA seq 705 aa AA seqDB search
MTEQPIQQPMFQVEVDENQIAIIRIHSIDNDENWLPENFAGELREVIGTLIYRQVQGAIF
ISTRANHFIQGLKPSLFKNKTNEQLLAFSQDAQAIMRELNTLKMPIVAAIDGNCFSVGLE
LSLACDYRIASDESHTFFAMPQVRSGLLPFAGGTQRLPRLIGLRSALPLMLFGEKITAET
AKGLGLVDRLVPKTRLLTDAYQLLLEKKIQKANHKKPLTFFKKWRKQIEGNSFLREKLLD
RTENAIWLKTFGNYPAVAKLMELLKEPHFKQGLMLEQQAFVELFNSATSQVLIELKKTER
AMKDKYRIRGNVRDVAQVSILGSGYMGAGIAYLTANNAKVPVRIKDIHPSEIRKALRTCF
ELMQKSTDKNQLNHGEMIQRMNLITGGERLVAAKSTDFVIEAVYEDLKLKQRMLAESESY
YSEQTIFATNTSTFAIKDIAACAIRPENVIGLHYFSPVTTQKMVEIIPHSATGEHTIATA
IHFAIQQGKIPLLVADKQGFFINRVLTPLLLEAVQCLIDGESIEFIDRSLQEFGFKLGPL
AMIDEMGLDVLVKSNSALVSELGSRFSLPQAVDLLFRNERKGCKNKRGFYMYDRFGERLQ
EDKSIYHVMETIARNDLESEQIVRRCLLRMLNEAAWCLQDKIIASTDEGNVASVLAMGFP
EFRGGIYVYIEKIGAKEIVRQLHLHTKQYGKRFEPCEWLIRQAEQ
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaacccattcagcaaccgatgtttcaagtcgaagtagatgaaaatcagatt
gccatcattcgcattcactctattgataatgatgaaaactggcttcccgaaaattttgcc
ggcgaattaagagaagttatcggtacgctgatttatcgtcaggtacaaggtgcgattttt
atttcgacacgggcaaatcattttattcagggcttaaaaccgagccttttcaaaaacaag
acaaatgagcaattacttgctttttcccaagatgcacaagcgattatgcgagagttaaat
acgctgaaaatgccgattgtcgccgctatcgacgggaattgctttagtgtcggtctggaa
ctttccttagcttgcgattaccgtatcgccagtgatgaatcgcatactttctttgcgatg
ccgcaagtccgttccggcttattaccttttgccggcggtacgcaacgtttaccgcgttta
atcggtttacgttccgcgctaccgttaatgttattcggcgaaaaaataactgccgaaacc
gccaaaggattgggtttggttgatcgattggtgcctaaaactcgtcttttaaccgatgct
tatcaactcttactagagaagaaaattcaaaaagccaatcataaaaaaccgcttactttc
tttaaaaaatggcgtaagcagatcgaaggtaattcgttcttacgcgaaaaattgcttgat
cgtacggaaaatgcgatttggcttaaaacgttcggtaattaccctgcggttgccaaactg
atggaactgctcaaagagccgcactttaaacaagggttaatgctcgaacaacaagccttt
gtcgaattgtttaatagcgcaacctcacaagtattaatcgaattaaagaaaaccgaacgg
gcaatgaaggataaatatcgtattcgaggtaatgtacgtgatgtcgctcaagtcagtatt
ttaggttcgggctatatgggcgccggtattgcttatttaaccgccaacaatgctaaagta
ccggttcgcataaaagatattcatccgtcggaaattcgtaaagccttacgtacctgcttt
gaattaatgcaaaaatcaacggataaaaatcagcttaatcacggtgaaatgatccaacgt
atgaatctgattaccggcggagagcgattagtggcggcaaaatcaaccgattttgtgatt
gaagcggtgtatgaagatctcaaacttaaacaacggatgttagccgaaagtgaaagctac
tatagtgaacagaccatttttgcaacgaatacttcaacctttgcgattaaagatattgcg
gcttgtgcgattcgtccggaaaacgtaatcgggctacattatttcagcccggttaccacg
caaaaaatggtggaaatcataccgcatagcgcaaccggcgaacatacgattgcgacggcg
attcattttgccattcaacaaggcaaaatcccgttgttggttgctgataagcagggcttt
tttattaatcgagttttaacgccgttactgcttgaagcggtgcaatgtttaattgacggc
gaatcgattgaatttatcgatcgttcgttacaagaattcggcttcaaattaggcccgctt
gccatgatcgacgaaatggggctggatgtattggtcaaatcgaactcggctttagtcagc
gaattaggcagccgtttcagtttgcctcaagcggttgatttattgttccgaaatgaacgt
aaaggctgtaaaaacaaacgcggtttctatatgtatgatcgcttcggagaacgtttacag
gaagataaaagcatttatcacgtgatggaaaccattgcccgtaacgatttggaatccgaa
cagattgtccgccgttgcctgttacgtatgctcaacgaagcggcttggtgtttacaggat
aagattatcgcctcgaccgacgaaggtaatgtcgcttccgttctcgcaatgggctttccg
gagtttcgaggcggtatctatgtctatatcgaaaaaatcggtgcaaaagaaatcgtacgg
caattacacttacacactaaacaatacggtaaacgtttcgaaccttgcgaatggctaatc
cgacaagccgaacaataa

DBGET integrated database retrieval system