KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0892Help
Entry
APL_0892          CDS       T00476                                 

Gene name
fdxG
Definition
formate dehydrogenase, nitrate-inducible, major subunit (EC:1.2.1.2)
Orthology
K00123  
formate dehydrogenase major subunit [EC:1.2.1.2]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APL_0892 (fdxG)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    APL_0892 (fdxG)
  Energy metabolism
   00680 Methane metabolism
    APL_0892 (fdxG)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.2  formate dehydrogenase
     APL_0892 (fdxG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1033523..1034110
Genome map
AA seq 195 aa AA seqDB search
MQISRRKFFKVCAGGMAGTSAAMLGFAPATALAAPREYKLLRAKETRQTCTYCSVGCGML
MYSLGDGAMNSRGKLFHVEGDPDHPVSRGALCPKGAGVLDYVNSPNRLQYPEYRAPGSDK
WERISWHDAIHRIAKLMKEDRDANWQDVNEEGTVVNRWTTTGLLCGSATSNETSLVSQKW
ARALGLVVIDQVAST
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctcaagacgtaagttctttaaggtctgtgcaggtggtatggcgggtacttct
gcggcgatgttgggctttgccccggcaaccgcattggcagccccgcgcgaatataaactt
ttgcgtgcaaaagaaactcgccaaacctgtacatactgttctgtcggctgtggtatgttg
atgtatagcctcggcgacggtgcaatgaattcaagaggaaaacttttccatgtggaaggc
gatcctgaccatccggtaagtcgcggcgcactttgtcctaaaggcgcaggcgtattagac
tatgtaaacagtccgaatcgtttacaatatcctgaataccgcgcgccgggttcggataaa
tgggaacgaatttcttggcacgacgcgattcatcgtattgcaaaattaatgaaagaagac
cgcgatgcgaactggcaagatgtcaatgaagaaggaactgtcgtcaatcgttggaccacc
accggtttactttgcggttccgcaacaagtaacgaaacctctcttgtttcccaaaagtgg
gctcgtgcgctcggtttagttgtaatcgaccaagtagcgagtacctga

DBGET integrated database retrieval system