KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0892Help
Entry
APL_0892          CDS       T00476                                 

Gene name
fdxG
Definition
formate dehydrogenase, nitrate-inducible, major subunit (EC:1.2.1.2)
Orthology
K00123  
formate dehydrogenase major subunit [EC:1.2.1.2]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apl01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:apl00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:apl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1033523..1034110
Genome map
AA seq 195 aa AA seqDB search
MQISRRKFFKVCAGGMAGTSAAMLGFAPATALAAPREYKLLRAKETRQTCTYCSVGCGML
MYSLGDGAMNSRGKLFHVEGDPDHPVSRGALCPKGAGVLDYVNSPNRLQYPEYRAPGSDK
WERISWHDAIHRIAKLMKEDRDANWQDVNEEGTVVNRWTTTGLLCGSATSNETSLVSQKW
ARALGLVVIDQVAST
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctcaagacgtaagttctttaaggtctgtgcaggtggtatggcgggtacttct
gcggcgatgttgggctttgccccggcaaccgcattggcagccccgcgcgaatataaactt
ttgcgtgcaaaagaaactcgccaaacctgtacatactgttctgtcggctgtggtatgttg
atgtatagcctcggcgacggtgcaatgaattcaagaggaaaacttttccatgtggaaggc
gatcctgaccatccggtaagtcgcggcgcactttgtcctaaaggcgcaggcgtattagac
tatgtaaacagtccgaatcgtttacaatatcctgaataccgcgcgccgggttcggataaa
tgggaacgaatttcttggcacgacgcgattcatcgtattgcaaaattaatgaaagaagac
cgcgatgcgaactggcaagatgtcaatgaagaaggaactgtcgtcaatcgttggaccacc
accggtttactttgcggttccgcaacaagtaacgaaacctctcttgtttcccaaaagtgg
gctcgtgcgctcggtttagttgtaatcgaccaagtagcgagtacctga

DBGET integrated database retrieval system