KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0996Help
Entry
APL_0996          CDS       T00476                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:apl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1151717..1152685
Genome map
AA seq 322 aa AA seqDB search
MKTFTLENSFLKITLSDFGAAWLSCVVKHPKGEREVLVTTSAENWQNQTAYFGATCGRYA
NRIANAEYQLNGKTYTLVKNDGKNTLHGGANGADKQIWQAEQLDPQAVKFSRIFADGEQG
FGGEVNAVVTYRLNGKEVEIEFEATANQDTPLCFTNHAYFNLLGAGDVLSHQLMINADEY
LPVGADGIPILPFKAVAHTGFDFSTPKLIGQDLLKDTDQQLVKGYDHAFKLVKNSAKPTA
CLTVEDLALELNTSMPALQCYSGNWLGGQPNLSGSTYQDYAGVALEPEFFPDSPNQAELA
KFGGITKAGERYKHDIRYTFHF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttaccctagaaaactcatttcttaaaattacgttatccgacttcggtgcc
gcttggctttcttgtgtggtgaaacacccgaaaggcgaacgtgaagtgttagttacgact
tctgcagaaaattggcaaaatcagaccgcttactttggagcaacttgcggacgttatgcc
aaccgtatcgctaatgccgaatatcagcttaacggcaaaacctatactttggttaaaaat
gacggtaaaaacactttacacggcggtgctaacggggcggataaacaaatttggcaagcg
gagcagcttgatccgcaagcggtcaaattcagccgaatttttgcagacggcgaacaaggt
ttcggcggtgaagtgaatgccgttgtgacttatcgtttgaatggaaaagaagtcgaaatt
gaatttgaagcaaccgccaatcaagataccccgctctgttttaccaatcacgcttatttc
aatttactcggcgcaggtgatgtgctttcgcatcaattgatgattaacgcagacgaatat
ttaccggtcggtgcagacggtatcccgattttaccgtttaaagcggttgctcacaccggt
tttgatttttcaacgcctaaacttatcgggcaagacttgctgaaagataccgatcaacag
ctggtaaaaggctacgatcacgctttcaaattggtaaaaaactctgcaaaaccgaccgct
tgtttaacggttgaagatcttgcacttgaactcaatacctcaatgccggcactacaatgc
tattcgggaaattggcttggcgggcaaccaaatctgagcggttcaacttatcaagattac
gccggtgttgctttagaaccggagtttttccccgattcgccaaaccaagccgaactggca
aaatttggtggcattaccaaagcaggcgaacgctataaacacgatattcgttacaccttt
cacttttaa

DBGET integrated database retrieval system