KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0997Help
Entry
APL_0997          CDS       T00476                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    APL_0997 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    APL_0997 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    APL_0997 (lacZ)
Enzymes [BR:apl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     APL_0997 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152710..1155730
Genome map
AA seq 1006 aa AA seqDB search
MILPNYFQDPNTLHVNTVEHHAYFIPHQQNETALSGKREQSDYFTLLNGQWDFNYFQSYH
DLPDNFLDIAFEHKIPVPANWQNHGFDHHHYTNINYPFPFDPPFVPHQNPCGVYHRTVQL
TPKSNKRYLLNFEGVDSCLFVYVNKQFVGYSQISHNTSEFDVSDYLQAGTNHLTVVVLKW
CDGSYLEDQDKFRMSGIFRDVYLLEREQNYLQDFFIQYELDDELRHANLKVETLFSRQPQ
AIEYQLLNPKGFTVFNQTDTHLNIEVEDIQLWNAEKPQLYTLILRTAEEVIVQKIGFRKV
EIKDGILLFNQQPIKFKGVNRHDSDPKTGYAISYAQAHKDLQLMKQHNINAIRTAHYPNA
PWFSELCDQYGFYLIGESDVESHGASMLTVKMPEPSILLNHQNDLQTERIRQDMIDNYCY
FARDPLFKKAILDRQQANVERDKNRTSIIIWSLGNEAGYGANFEAAAAWIKQRDKSRLVH
YESSIYQHSADNNDLSNLDFYSEMYGSTEDIDRYCATAQAKPFVLCEYSHAMGNSNGDAE
DYWQAFHRHPQSCGGFVWEWCDHAPYRANGQFGYGGDFGESPHDGNFCMDGLVSPDRIPH
SNLLELKNVNRPARAELIDNQIVIHNYLDFTDLADYLTIDYEFVENGVVTSGGNLSVSCQ
PHGSVVLPIELPKNNGHLWLLNLNYRLNTAVELLDEAHSLGFEQLNLFSENKLVLPKFTI
ENSAFEVQEDRFHINVHNGQFSYQLDKQKGIFNRIEKAGKAIIQQSLDFNIWRAPTDNDR
LIREAWQNAGYDKAYTRAYEIQWQQSEQAVEFSVKSAIVSISRGRILTLDIRYRIFNDGQ
ISVEINAIRPTELPYLPRFGLRFWLAKAENTVEYFGYGEQESYVDKHHLANLGIYHTTAK
QNHTDYVKPQENGSHYGCEYLKSENLFVSASQPFSFNLSPYTQEELTAKKHCYELQESDY
SVLCIDYKMSGIGSNSCGPNLKDQYRLMESEFKIRFDLIFDKTIRQ
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgatactgccgaattacttccaagatcccaatacgctccacgtaaataccgttgagcat
cacgcttattttattccgcatcaacagaatgaaaccgctttaagcggtaagcgcgaacaa
tccgattactttactttgcttaacggacaatgggattttaattacttccaaagctatcat
gacttgccggataatttccttgatattgcgtttgaacataaaattccggtgccggcaaat
tggcaaaatcacggttttgatcatcatcactatacgaatattaactacccgtttccgttt
gatccgccttttgtaccgcatcaaaatccatgcggcgtgtatcatcgtaccgtacaactt
accccgaaaagcaataagcgttatttgctcaattttgaaggcgtagattcctgtttattt
gtttatgtgaataaacagtttgtcggttatagtcaaattagccacaacacctccgaattt
gatgttagcgattatttacaagccggcaccaaccatttaaccgtcgtggtactgaaatgg
tgtgacggtagctatttagaagaccaagacaaattcagaatgtcaggcattttccgtgat
gtctatttgcttgagcgtgaacaaaattatctgcaagatttctttattcaatatgaattg
gatgatgaattacgtcacgcaaatctgaaagtggaaacactttttagccgtcagccgcaa
gcgattgaataccaattactcaacccgaaaggctttaccgttttcaatcaaaccgatacg
catctcaatattgaggtagaagatattcagttatggaatgccgaaaagccgcaactttac
accttaattttgcgtactgcggaagaagtgattgtgcaaaaaatcggttttagaaaagtg
gaaatcaaagacggcattttattatttaatcagcaaccgattaaatttaaaggagtaaac
cgccacgatagcgatccgaaaaccggttatgcgattagctacgcacaagcgcataaagat
ttacagctgatgaagcaacataatatcaatgcaatccgcactgcccattatccgaatgca
ccttggtttagtgagttatgcgatcaatacggtttttatttgattggcgaaagcgatgtc
gagtcacacggtgcgtcaatgctcaccgtcaaaatgcctgagccgagcattctcttaaat
caccaaaatgatttgcaaactgagcgtatccgtcaagatatgatagataattactgttac
tttgcccgtgatccgctgttcaaaaaagcgattttagaccgccaacaagccaatgtggaa
cgagataaaaatcgtacttcgattattatttggtcgttggggaatgaagccggctatggt
gccaattttgaagcggcggcagcgtggattaagcaacgtgataaatctcgtttagtgcat
tacgaaagctcgatttatcaacattccgccgataataatgatctatcgaatttggatttt
tatagtgaaatgtacggctcaaccgaagatatcgaccgctattgtgccactgcgcaagcc
aaacctttcgtgttgtgtgaatacagccatgcaatgggtaactcaaacggcgatgcggaa
gattattggcaagcgttccatcgtcatccgcaatcatgcggcggttttgtgtgggaatgg
tgcgatcacgccccttaccgtgctaacggacaattcggttacggcggtgatttcggcgaa
agtccgcacgatggaaatttctgtatggacggtttggtttcaccggatcgtattccgcac
agtaacttattagagcttaaaaatgtgaatcgccctgcacgtgccgaattaatcgataac
caaattgtgatccacaactacttggatttcactgatcttgccgattatttaacgattgat
tacgaatttgtcgaaaacggcgtggtgacaagcggtgggaatttatccgtttcttgccaa
ccgcacggcagcgtagtattaccgattgagttaccaaaaaataacgggcatttatggcta
ctgaatttaaattatcgcttaaataccgcggtcgaattattagacgaagcgcattcactt
ggcttcgagcagctcaatttatttagcgaaaataaattagtattaccaaaattcacaatt
gagaacagtgcatttgaagtacaagaagatcgcttccacattaacgtacacaacggtcaa
tttagttatcaattagataaacagaaagggattttcaaccgtattgaaaaagccggtaaa
gcgattatccaacaatcgttagattttaatatttggcgtgcgccaaccgacaatgatcgc
ctcattcgtgaggcgtggcaaaatgccggctacgataaagcctataccagagcgtatgaa
attcagtggcagcaaagcgaacaagcggtcgaattttcagtaaaatctgcaattgtgtca
atttctcgcggtcgcattttaacactggatattcgttatcgtatcttcaatgacgggcaa
atttcggtggaaatcaacgcaatccgtccaaccgaattaccgtatttacctcgtttcggt
ttacgcttctggcttgctaaagcggaaaatacggtcgaatatttcggttacggcgagcaa
gaaagctatgtggataagcaccatttagcaaatttaggcatctatcatactacggcaaaa
caaaatcataccgattatgttaaaccgcaggagaacggcagccattacggttgcgaatat
ctcaaatcggaaaatctgtttgtgagtgcaagccaaccgtttagctttaatctctcgccc
tatacgcaagaggaattaacggcgaaaaaacattgctacgagctacaagaatccgattac
agcgtgctatgtatcgattacaaaatgagtggtatcggttcaaactcatgcggcccaaac
ttaaaagatcaatatcgcttaatggaaagcgaatttaaaataagatttgatctcatattt
gataaaaccatccgtcaataa

DBGET integrated database retrieval system