KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1011Help
Entry
APL_1011          CDS       T00476                                 

Gene name
adh2
Definition
(GenBank) aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00010  Glycolysis / Gluconeogenesis
apl00071  Fatty acid degradation
apl00350  Tyrosine metabolism
apl00620  Pyruvate metabolism
apl00625  Chloroalkane and chloroalkene degradation
apl00626  Naphthalene degradation
apl00650  Butanoate metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01130  Biosynthesis of antibiotics
apl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_1011 (adh2)
   00620 Pyruvate metabolism
    APL_1011 (adh2)
   00650 Butanoate metabolism
    APL_1011 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    APL_1011 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    APL_1011 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APL_1011 (adh2)
   00626 Naphthalene degradation
    APL_1011 (adh2)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APL_1011 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     APL_1011 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABN74105
UniProt: A3N119
Position
1175244..1177859
Genome map
AA seq 871 aa AA seqDB search
MANNAKNAQPYDAQTEVNQLVENGLKALEEFRQLNQEQVDYIVAKASVAALDKHGVLAMH
AYEETGRGVFEDKATKNLFACEYVVNNMRHLKTAGIISEDNVTGITEIADPVGVVCGITP
TTNPTSTTIFKALIALKTRNPIVFAFHPSAQQSSAHAAQVVYDAAVAAGAPKNCVQWIKT
PSMEGTSALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKTAKLEQAVY
DIVMSKSFDNGMICASEQAAIVDKEIYADFVKEMQSYGVYLVNKKEKVLLEKFIFGVDKA
KDENCAGAKLNAAVVGKPAAWIAEQAGFSVPPKTNILLAECAFVGEGEPLTREKLSPVLA
LLKSNSTEHGLELSEAMVNFYGLGHSAAIHTQNVELAKTFGERVKAIRVIWNSPSTFGGI
GDVYNSFLPSLTLGCGSYGKNSVSNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDS
IQYLKSMKDAEKVMIVTDRSMVDLGFVDRITDQLRQRRNKVMIQLFTDVEPNPSLQTVQR
GTELMRSFQPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLG
RKAKFVGIPTTSGTGSEVTPFAVITDGDIKYPLADYSLTPTIAIVDPALVMSVPAHVAAD
TGLDVLTHATEAYTSILANDYTDGLALQAIKLVFENLEKSVKEFDEVAREKMHNASTMAG
MAFANAFLGICHSMAHKIGGKFHTIHGRTNAILLPHVIRYNGTRPTKVATWPKYTNYVAD
KRFQDIARILGLPATTPEEAVESYAKAVHDLAVRCGIKMSLREQGIDEQEFLDARRELAL
NAFEDQCTPANPRLAMVEDMEEIMTKAYYGK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaatgcaaaaaatgcacaaccatatgatgctcaaaccgaagtaaatcagcta
gttgaaaacggtttaaaagctctcgaagaatttcgtcagcttaaccaagaacaagtggat
tacatcgttgcaaaagcctccgtggcggcattggataaacatggcgttctagcaatgcac
gcttatgaagaaacggggcggggcgtatttgaagacaaagcgactaaaaatctatttgct
tgtgaatatgtcgtaaataatatgcgacatttaaaaacggcggggataattagtgaagat
aacgtaaccggtattaccgaaatcgccgaccctgtcggtgtcgtatgcggcataactccg
acaaccaacccaacctcaaccactatcttcaaagcgttaatcgccctcaaaactcgtaac
ccaatcgtttttgctttccacccttccgcacaacaatcttccgctcatgccgctcaagtt
gtatatgatgccgccgttgctgccggcgcaccgaaaaattgtgtgcaatggattaaaacc
ccgtcaatggaaggtacttccgcattaatgaaacatccgggtattgcaaccattcttgct
accggcggtaatgccatggttgaagcggcatattcttgcggtaagccggcattaggcgta
ggggcgggtaacgtaccggcttatgtggaaaaaactgctaaactagaacaagctgtttac
gacattgtgatgtcaaaatcttttgacaacggtatgatttgtgcatccgaacaagcggcg
attgtcgataaagaaatctatgccgatttcgtgaaagaaatgcaatcttacggcgtatat
ctggtaaataaaaaagaaaaagtactgttagaaaaattcattttcggtgtggataaagcc
aaagatgaaaactgtgccggagcaaaattaaatgcggcggtcgtaggtaaaccggcggca
tggattgccgaacaagcgggttttagcgtgccaccaaaaacaaacatcctacttgcagaa
tgtgcgtttgtcggtgaaggcgaaccgcttactcgtgagaaattatcaccggtacttgca
ttattaaaatcgaattcaaccgaacacggtttagaactttccgaagcgatggtaaatttc
tacggtttaggtcactcggcggcaatccatacgcaaaatgtcgaattagcaaaaacattc
ggcgagcgcgttaaagcgattcgtgtaatttggaactcgccatcaacattcggtggtatc
ggtgacgtgtataactcattccttccgtccctcacattaggttgtggttcttacggtaaa
aactccgtaagtaacaacgtaagtgcggtgaacttaattaatattaaacgtgtgggcaga
cggagaaacaatatgcaatggtttaaagttccatcaaaaatctactttgagcgtgattca
attcaatatctcaaatcaatgaaagatgcggaaaaagtgatgatcgtgaccgaccgctca
atggtagatctcggttttgtcgatagaattaccgaccaattacgccaacgtcgtaataaa
gtgatgattcagttatttaccgatgttgaaccgaatccaagtttacaaaccgtacaacgc
gggacggaacttatgcgtagcttccaaccggataccattattgccttaggtggcggctcg
ccgatggatgcggcaaaagtaatgtggttattctatgaacaaccggaagtggatttccgt
gatttagttcagaaatttatggatattcgtaaacgtgcgttcaaattcccgcaattaggt
cgtaaagcgaaatttgtcggtatcccgaccacatccggtaccggttccgaagttacgccg
tttgcggtcattactgacggcgatattaaatatccgttggccgactactctctcacgccg
acaattgcgattgtagatcctgcattagtgatgtcagtgccggctcatgttgcggcggat
accggtttagacgtattaactcacgcaactgaggcttatacttcaattcttgccaacgac
tacaccgacggtttagcgttacaggcaattaaactggtattcgaaaatttagaaaaatcc
gtgaaagaatttgatgaagtcgctcgcgagaaaatgcacaatgcttcaactatggcaggt
atggcgtttgcaaacgcattcttaggtatttgtcactcaatggcgcataaaatcggcggt
aaattccatacgattcacggtcgtaccaatgcgattttattaccgcacgtaattcgttat
aacggtactcgcccgactaaagtggcaacttggccgaaatacacaaactatgttgcggat
aaacgcttccaagacatcgcacgtattttaggtttaccggcgacaacgcctgaagaagcg
gtggaatcttacgctaaagcggtacatgatttagcagtacgttgtggtattaaaatgtct
ttacgtgaacaaggtattgacgaacaagagttcttagacgcacgtcgtgaacttgcatta
aatgcctttgaagaccaatgtactccggcaaatccacgtcttgcaatggtagaagatatg
gaagagataatgacaaaagcttactatggcaaataa

DBGET integrated database retrieval system