KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1124Help
Entry
APL_1124          CDS       T00476                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APL_1124 (pfkA)
   01230 Biosynthesis of amino acids
    APL_1124 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_1124 (pfkA)
   00030 Pentose phosphate pathway
    APL_1124 (pfkA)
   00051 Fructose and mannose metabolism
    APL_1124 (pfkA)
   00052 Galactose metabolism
    APL_1124 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    APL_1124 (pfkA)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     APL_1124 (pfkA)
Protein phosphatases and associated proteins [BR:apl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     APL_1124 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1299786..1300760)
Genome map
AA seq 324 aa AA seqDB search
MAKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRS
VSETINRGGTFLGSARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEF
GYPCIGIPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIEDGFNKGKRHAIIAITELMTDVQALAKEIE
DRFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGHGGRCIGIKNENLVHHD
IIDAINNMRRPFKEELFEAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaatcaaaaaaattgccgtgctaaccagtggaggtgatgcaccgggtatg
aatgccgcaattcgtggcgtagtccgcgccgcattaaacgaaggcttagaagtatatggc
gtacaagacggttattacggtttatataccgatagagtaattccgcttgatcgtcgttcc
gtatcggaaacgatcaaccgcggcggtacttttttaggttcggcgcgcttcccgcagttt
aaagatcctgacgtacgtaaaaaatcggtagaaaccttaaaaaaatacgatattgatgcg
ctggtcgttatcggcggagacggctcgtatatgggagcgaaacttataaccgaagaattc
ggttatccgtgtatcggtattccgggtacgatcgataatgatatcgtcggtacggattat
actatcggttaccaaaccgcattggaaacggcggtggaagcgattgaccgtttacgcgat
acttctacctcgcatcagcgtatttcaatcgttgaaattatgggacgccactgcggcgat
ttaaccattagtgcggcgcttgccagcggttgcgaatatattatcgtgccggaaaaaggt
ttggataaagagtcgctaatgcgtaatatcgaagacggttttaataaaggtaaacgtcat
gcgattattgcgattaccgaattaatgacggacgttcaggcattggcaaaagaaatcgaa
gaccgcttcggtcatgaaacgcgcgcaaccgtattaggtcacattcaacgtggcggtgca
ccttgcccgttcgaccgtattttagcttcccgtatgggcgtatatgcggtggatctgtta
ttacaaggtcacggcggtcgttgtatcggtatcaaaaatgagaatttggtacatcacgat
attattgatgcgattaacaatatgcgccgcccgttcaaagaagaactgtttgaggcggct
agaaaattattctaa

DBGET integrated database retrieval system