KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1124Help
Entry
APL_1124          CDS       T00476                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00010  Glycolysis / Gluconeogenesis
apl00030  Pentose phosphate pathway
apl00051  Fructose and mannose metabolism
apl00052  Galactose metabolism
apl00680  Methane metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01130  Biosynthesis of antibiotics
apl01200  Carbon metabolism
apl01230  Biosynthesis of amino acids
apl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_1124 (pfkA)
   00030 Pentose phosphate pathway
    APL_1124 (pfkA)
   00051 Fructose and mannose metabolism
    APL_1124 (pfkA)
   00052 Galactose metabolism
    APL_1124 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    APL_1124 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    APL_1124 (pfkA)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     APL_1124 (pfkA)
Protein phosphatases and associated proteins [BR:apl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     APL_1124 (pfkA)
Messenger RNA biogenesis [BR:apl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     APL_1124 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABN74214
UniProt: A3N1C8
Position
complement(1299786..1300760)
Genome map
AA seq 324 aa AA seqDB search
MAKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRS
VSETINRGGTFLGSARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEF
GYPCIGIPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIEDGFNKGKRHAIIAITELMTDVQALAKEIE
DRFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGHGGRCIGIKNENLVHHD
IIDAINNMRRPFKEELFEAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaatcaaaaaaattgccgtgctaaccagtggaggtgatgcaccgggtatg
aatgccgcaattcgtggcgtagtccgcgccgcattaaacgaaggcttagaagtatatggc
gtacaagacggttattacggtttatataccgatagagtaattccgcttgatcgtcgttcc
gtatcggaaacgatcaaccgcggcggtacttttttaggttcggcgcgcttcccgcagttt
aaagatcctgacgtacgtaaaaaatcggtagaaaccttaaaaaaatacgatattgatgcg
ctggtcgttatcggcggagacggctcgtatatgggagcgaaacttataaccgaagaattc
ggttatccgtgtatcggtattccgggtacgatcgataatgatatcgtcggtacggattat
actatcggttaccaaaccgcattggaaacggcggtggaagcgattgaccgtttacgcgat
acttctacctcgcatcagcgtatttcaatcgttgaaattatgggacgccactgcggcgat
ttaaccattagtgcggcgcttgccagcggttgcgaatatattatcgtgccggaaaaaggt
ttggataaagagtcgctaatgcgtaatatcgaagacggttttaataaaggtaaacgtcat
gcgattattgcgattaccgaattaatgacggacgttcaggcattggcaaaagaaatcgaa
gaccgcttcggtcatgaaacgcgcgcaaccgtattaggtcacattcaacgtggcggtgca
ccttgcccgttcgaccgtattttagcttcccgtatgggcgtatatgcggtggatctgtta
ttacaaggtcacggcggtcgttgtatcggtatcaaaaatgagaatttggtacatcacgat
attattgatgcgattaacaatatgcgccgcccgttcaaagaagaactgtttgaggcggct
agaaaattattctaa

DBGET integrated database retrieval system