KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1240Help
Entry
APL_1240          CDS       T00476                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APL_1240 (malQ)
Enzymes [BR:apl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     APL_1240 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425628..1427646
Genome map
AA seq 672 aa AA seqDB search
MKSLHPYLNPYFFDEYGRRRYASQAVCHKIAKRLGSPKSKPIIPPVKVATEGQAVYIRLN
LANSNKALQARWQLHLENGEIRCGKVKRNAINLPKDLPLGYHHLQLKSEHYSLNCRLIIT
PKTAFQPKELQQKQKLWGAILQLYTLRSEHNWGIGDFSDLKTFLSRLAEKGGDFVGLNPI
HAIFPANPESASPYSPSSRLWQNIIYIDVAAIDAFQQSSEAQAWFHSAEVQQQLIEARAK
DYVDYSQVMGLKLEGLRLAYATFVQQDQQAFEQFINEYGESLKVQGTFDALHYWLSSQFS
KQWGWNFWAQEYQDYASNAVQTFQTEHSQLVRFYMWLQFVAQQQLRACNQLAKALNMPIG
LYRDLAVGVADNGAETWADKELFVLDASVGAPPDIMAPNGQNWGLSPMHPEVLQARGYQP
FIDLLRANMKDCGALRIDHILGFARMWWVAKGDSAKNGAYVRYPLEDLLAILALESQRNQ
CLIIAEALGTVPKGMLQKLEDKGILAYNIFYFEWDQHGSKPLANYPYQAMTTLSTHDLPT
LQGYWKGYDFDLGKKFGVYPSEKVLNILKQSRHFNKEAIRQAVEKVQDLAKDSEGVNLKF
VHQLQMYVADTNSALFGTQPEDWLNMLEPVNIPGTSNEYPNWRRKLSHTINEIFNHEQIN
QLLDAFEQKRNK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgcttcacccataccttaatccttatttctttgatgaatatggcagacgccgt
tatgccagccaagcggtctgtcacaaaattgcaaaacgcttaggttctcctaaaagcaaa
cctattattcctcctgtaaaggtagcaacagaaggacaagcggtctatattcgactaaat
cttgcaaatagcaataaagcattacaagctcgctggcaacttcacttagaaaacggtgaa
atacgttgcggtaaagtaaaacgtaatgcgatcaatttaccgaaagatctgcctctcggc
tatcatcatttacagcttaaaagtgagcattattcactgaactgccgcctgattattacg
ccgaaaactgctttccagccaaaagaattacaacaaaaacaaaaattatggggcgcaatt
ttacaactctatacgcttcgttccgaacataattggggcatcggcgattttagcgatttg
aaaaccttcttaagtcgacttgctgaaaaaggtggtgattttgttgggctaaatccaatt
catgcgattttcccagccaatccggaaagtgccagcccttatagcccctcatctcgttta
tggcaaaacattatttatatcgatgtagcagcgattgatgccttccaacaatctagcgaa
gcgcaagcctggtttcattccgcagaagttcaacaacagcttattgaggcaagagcaaaa
gactacgtagattattcgcaagtgatgggcttaaaactcgaaggattacgtttagcctat
gccactttcgttcagcaagatcaacaagctttcgaacaatttatcaatgaatacggcgaa
agcctaaaagtgcaaggtacattcgacgcactacattattggttatccagccaatttagc
aagcaatggggttggaatttctgggcgcaagaatatcaagactacgcatcaaatgcagta
cagacattccaaacggaacatagccaattagttcgtttctatatgtggttgcaatttgtg
gctcaacagcaattaagagcgtgtaatcaattggcaaaagcacttaatatgcctatcggc
ctttaccgtgatttagcggtaggcgttgccgataacggtgcggaaacttgggcggataaa
gagttatttgtgctagatgcctctgtcggtgcaccaccggatattatggcaccaaacgga
caaaactggggcttatcaccgatgcatccggaagtgctacaagctagaggatatcagcca
tttattgatttattgcgtgccaatatgaaagattgcggtgcattacgtatcgaccacatt
cttggttttgcacgtatgtggtgggtggcaaaaggcgattcggctaaaaacggcgcttat
gtacgttatccgctagaagatttgttagcaattcttgcgttagaaagtcagcgaaatcag
tgtttaatcattgctgaagcacttggtacagtaccgaaaggtatgctacagaaattagaa
gacaaaggtattctcgcttataacattttctattttgaatgggatcaacacggcagtaag
ccattagctaattatccatatcaagcgatgacgacactcagtacgcatgatttaccaacc
ctacaaggctactggaaaggctacgactttgatttaggcaagaaatttggtgtttaccca
agtgagaaagtgcttaatattctgaaacaaagtcgccatttcaataaagaagcgattaga
caagcggtcgaaaaagtccaagatcttgcaaaagatagcgaaggcgtaaacttaaaattt
gtacatcaattacaaatgtatgtagcggataccaattctgctttatttggcactcagccg
gaagattggctaaatatgctcgagccggtaaatattcccggaacaagtaatgaatatccg
aattggcgtagaaaattaagccatacaattaatgagattttcaaccacgagcaaatcaat
caactacttgatgctttcgaacaaaaacgaaataaataa

DBGET integrated database retrieval system