KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1379Help
Entry
APL_1379          CDS       T00476                                 

Gene name
ccp
Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581367..1582767
Genome map
AA seq 466 aa AA seqDB search
MKKYLLSAIAAAGIGYFSLVGYAYWFDKEQAPKLLASADLPESHKAVAGVMFENGCQYCH
SANAELPAYAKLPIADQVMAEDIEKGLKFFRLDHLIEGMKDPSKLSEADLAKLEQVIRND
EMPVAKYIHIHWGSRPDEAQKKIILDWITAQRQAHFLPKAEGADATRLVQPIPDQLPTDP
HKVALGEGLYFDGRLSDDGTIQCHTCHQLAQAGVDNLPVSEGINGLKGGINAPTVFNAAF
NKWQFWDGREKTLADQAGGPPVNPVEMGSKNWDEILARLSKDEEFMKRFHEIYPTLTQAN
VTDAIGEYEKTLITPNSAFDRFLKGEQNALTDVQKRGYEHFKNAKCDTCHTGTAMGGQSF
EYMGLYADYFKDRGTELTEADHGRYAVTKDPSDMHRFKVPTLRNVALTAPYMHDASAKDL
KEAVRIMGIYQSNKQFSETELNELVAFLESLTGEYKGKLLTNEKVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttactttcggcaattgccgccgccggcatcggctatttttcacttgtg
ggctacgcctattggtttgataaagagcaagcgccaaaattattagcgtccgcagactta
cccgaatcgcataaagcggtcgcaggagtcatgtttgaaaacggctgccaatattgccac
tcggctaatgcggaattaccggcttatgccaagttaccaatcgcagaccaagtgatggct
gaagatattgaaaaaggtcttaagttcttccgtcttgatcatctgattgaaggaatgaaa
gatccgagcaaactttcagaagccgatcttgctaaattagaacaagtaattcgcaatgac
gaaatgccggttgctaaatatattcatatccactggggttctcgtcctgacgaagctcag
aaaaaaattatcttagattggattaccgcacaacgccaagcacacttcttaccaaaagcg
gaaggtgcggacgctactcgcttggttcagccgattcctgatcaattaccgaccgatccg
cataaagtagctttaggtgaagggctttattttgacggacgtttatctgatgacggtacg
attcaatgccatacttgccaccaattagcgcaagccggggtcgataacttaccggtatcg
gaagggattaacggcttaaaaggcggtatcaacgcgcctacggtgtttaatgcggcattt
aataaatggcaattctgggacggtcgtgagaaaaccttagcggatcaagcgggcggccca
ccggtaaacccggttgaaatgggttcaaaaaactgggatgaaattctcgccagactaagc
aaggacgaagaatttatgaaacgtttccacgagatttacccgactcttacgcaagcgaac
gtcaccgatgcaatcggtgaatatgaaaaaacgcttattacgccgaacagtgcattcgac
cgcttcttaaaaggcgagcaaaatgcgctaaccgatgtacaaaaacgcggttacgagcat
ttcaaaaatgcgaaatgcgatacttgccataccggtacggcaatgggcggacaatcattt
gaatatatgggcttatatgccgattacttcaaagatcgcggtacggaattaaccgaagcg
gatcacggtcgttatgcggtaactaaggatccaagcgatatgcaccgtttcaaagtgccg
actttacgtaacgtggcgttaactgcaccatatatgcacgatgcaagtgcgaaagactta
aaagaagcggttcgtattatgggtatttaccaaagcaataaacaattctctgagacagag
cttaatgagctagttgctttcttagaatcactgaccggtgaatataaaggcaaattacta
actaatgaaaaagtgaaataa

DBGET integrated database retrieval system