KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1499Help
Entry
APL_1499          CDS       T00476                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:apl00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:apl00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1714873..1716153
Genome map
AA seq 426 aa AA seqDB search
MNLYNIKHPEEQVNFAQGVRQGLGKDQGLFFPEVLPKFDDIDALLDLPLVERSQKILAAL
IGNELPQETVNAMVKNAFTFPAPLAKVNDYIYALELFHGPTLAFKDFGGRFMAQALASVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
ESDFDACQVLVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKAKRSDVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLKSGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALSDLGSAALNDAETEAALKAQYAEGYLCEPHGAIAYQALK
DQLQAGETGIFLCTAHPAKFKESVERILNIELPLPEALDKHNKMELLSDTMPADFAKLRE
YLLAGN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatacaacatcaaacacccagaagaacaagttaatttcgcacaaggcgtgcgc
caaggtttaggtaaggatcaggggttatttttccctgaagtgttaccgaaatttgacgat
attgatgcgttactggatttacctttggttgaacgcagccaaaaaattttggcggcactt
atcggtaacgaacttccgcaagaaacggtaaatgccatggtaaaaaatgcgtttactttc
cctgctccattagcaaaagtgaatgactatatttatgcacttgagctgttccacggcccg
acattggcatttaaagacttcggcggtcgttttatggcgcaagcactggcaagcgtgcgt
ggtgacggcaaaatcaccattttaaccgcaacctcaggcgacaccggtgcggcggtagcg
cacgcattttatggcttagaaaatatcaatgtagtgatcctttacccgaaaggcaaaatc
agcccgttacaagaaaaattattctgtaccttaggcggtaacattcgtaccgttgcgatt
gaatcggattttgacgcttgccaagtgttagtaaaacaagcgtttgacgatgctgaatta
cgtcaagcgatcggcttaaactccgcaaactcaatcaatatcagccgtttattagcgcaa
gtttgttattactttgaagcggtagcacaattaccgaaagcaaaacgttctgatgtagtg
gtttcagtaccaagcggtaacttcggtaacttaaccgctggtttaatcgcaaaaacctta
ggtttaccaattaaacgttttatcgcatcaaccaatgcgaatgacacagtgccgcgttat
ttaaaatcaggtaaatgggaaccgaacgcaacggtagcaacgctttcaaacgcaatggac
gtaagccgcccgaacaactggcctcgtgtggaagaattatttaaacgcaacggttgggcg
ttaagcgatttaggttcggcggcattaaacgatgcggaaaccgaagcggcattaaaagca
caatatgcggaaggttatttatgcgaaccgcacggtgcaatcgcttaccaagcgttaaaa
gatcagcttcaagcgggcgaaaccggtattttcctctgcaccgctcacccggcaaaattc
aaagaaagcgtagaacgtattcttaacatcgaattaccactaccggaagcattggataaa
cataacaaaatggaattattatccgacactatgccggcggatttcgccaaattacgtgag
tatttgttagcgggtaactaa

DBGET integrated database retrieval system