KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1673Help
Entry
APL_1673          CDS       T00476                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APL_1673 (rbsK)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     APL_1673 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1898947..1899858
Genome map
AA seq 303 aa AA seqDB search
MKKLCVLGSVNADHVIRVPYFPKAGETLKGGHYHIAYGGKGANQAVAAARVRNTSLVEVD
FIACIGADDIGRAMKQAFVQDGINPEHIVEVADQMTGIAMIQVADSGENSIVISAGANAN
LDESVVAQHQATIERADCLLVQLETPLQAVEKALKIAKANHTQVILNPAPAQPLSDEILA
NIDMITPNETETALLTGIQVVDEQTAQQAANVFHQKGIQTVLITLGAKGAFLSENGNGEI
IAGFKVTPVDTTAAGDTFNGALAIALLEGKSMRDAVMFAHKASSISVTRMGAQSSIPTRA
ELV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgtgtgttgggcagcgtaaatgcggatcatgttattcgagtgccttat
ttcccgaaagcgggcgaaacgctgaaaggcggtcattatcacattgcgtatggcggcaaa
ggggctaatcaggcagtagcggcggctcgtgtgcgaaatacatcgttagttgaggtggat
tttatcgcttgtatcggcgctgatgatattggacgagcgatgaaacaagcctttgtgcaa
gacggaattaatcccgaacacattgttgaagtagctgaccaaatgaccggcattgcgatg
attcaagtggcggattcaggcgagaatagcattgtaatttccgccggtgcaaatgcaaac
ttagatgaaagcgtggtggcacaacatcaagctacgattgaaagagcggattgcttactg
gttcagctggaaacgccgttacaagcggtcgaaaaagcgttaaaaattgctaaggcaaat
catactcaagtcattttaaatccggcaccggcacaaccgctctcagatgaaattttggcg
aatatcgatatgattaccccaaacgaaacggaaactgccttactgacaggcattcaagtg
gtcgatgaacaaaccgctcaacaagcagcgaatgtattccatcaaaaagggattcaaacc
gtgttaattactttgggggcgaaaggggcgtttttaagtgaaaacggtaacggtgaaata
attgccggctttaaagtcacaccggtggacaccaccgccgccggcgatacctttaacggc
gcattggcgattgctttattagaaggcaaatcaatgcgagatgcggtcatgtttgcccac
aaagcctcttcgatttcagtcactcgtatgggggcacaaagttctattccaactcgagcg
gaattagtttaa

DBGET integrated database retrieval system