KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1919Help
Entry
APL_1919          CDS       T00476                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_1919
Enzymes [BR:apl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     APL_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2152380..2153189
Genome map
AA seq 269 aa AA seqDB search
MKTEFIRQISQGISLEKCHELYVIRVAHKLGTAVVALQGAQLLSWQPATAKQDVLWLSEI
EPFQKGNAIRGGVPICYPWFGSVKSPSHGTARIREWSLSHYETDAEYAYLEFSLYDEQNI
IEAKIEMAFSQECHLIFTHYAEQEAQAALHSYFNVSNIEQTEVKGLPHECFDSLTKQFVQ
VPSPRKINENVDCIYSAEQAINRIEDMANQRTIQIEHIDASDVVLWNPWHKATSAMSETG
YQTMVCVETARINRKLQQGDSFEVIFKLV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgaatttattcgtcaaatcagccaaggtatcagcctcgagaaatgtcatgag
ttatatgtgattcgtgttgcacataagttaggaacagcagtagtggctttacaaggcgca
caattattaagttggcaaccggctacggcgaaacaagacgtattatggctttcggagatt
gagccgttccaaaaaggcaatgcgattcgcggcggtgtgccgatttgttatccgtggttc
ggttcggtaaaaagtccgtcacacggcacggctcgcattcgtgaatggtcgctcagtcat
tatgaaacggatgcggaatatgcttacttagaattttcgctctatgacgaacaaaatatt
atcgaagcgaaaattgaaatggcgtttagccaagaatgtcatttgattttcactcactat
gccgaacaagaagcgcaggcggcattgcatagctatttcaatgtatcgaatattgagcaa
accgaagtgaaaggcttaccgcacgaatgctttgattcattaaccaaacaatttgtacaa
gtgccttcgccgcgtaaaattaacgaaaatgtcgattgtatttatagtgcggagcaggct
attaatcgcattgaagatatggcgaatcaacgcacgattcaaattgaacacattgatgcg
agcgacgtcgtgttatggaatccgtggcacaaagcgacaagtgcgatgagcgaaaccggt
tatcaaacgatggtatgcgtcgaaaccgcccgtatcaatcgaaaattacagcaaggcgat
agttttgaagtgatctttaaattagtttag

DBGET integrated database retrieval system