KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1919Help
Entry
APL_1919          CDS       T00476                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2152380..2153189
Genome map
AA seq 269 aa AA seqDB search
MKTEFIRQISQGISLEKCHELYVIRVAHKLGTAVVALQGAQLLSWQPATAKQDVLWLSEI
EPFQKGNAIRGGVPICYPWFGSVKSPSHGTARIREWSLSHYETDAEYAYLEFSLYDEQNI
IEAKIEMAFSQECHLIFTHYAEQEAQAALHSYFNVSNIEQTEVKGLPHECFDSLTKQFVQ
VPSPRKINENVDCIYSAEQAINRIEDMANQRTIQIEHIDASDVVLWNPWHKATSAMSETG
YQTMVCVETARINRKLQQGDSFEVIFKLV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgaatttattcgtcaaatcagccaaggtatcagcctcgagaaatgtcatgag
ttatatgtgattcgtgttgcacataagttaggaacagcagtagtggctttacaaggcgca
caattattaagttggcaaccggctacggcgaaacaagacgtattatggctttcggagatt
gagccgttccaaaaaggcaatgcgattcgcggcggtgtgccgatttgttatccgtggttc
ggttcggtaaaaagtccgtcacacggcacggctcgcattcgtgaatggtcgctcagtcat
tatgaaacggatgcggaatatgcttacttagaattttcgctctatgacgaacaaaatatt
atcgaagcgaaaattgaaatggcgtttagccaagaatgtcatttgattttcactcactat
gccgaacaagaagcgcaggcggcattgcatagctatttcaatgtatcgaatattgagcaa
accgaagtgaaaggcttaccgcacgaatgctttgattcattaaccaaacaatttgtacaa
gtgccttcgccgcgtaaaattaacgaaaatgtcgattgtatttatagtgcggagcaggct
attaatcgcattgaagatatggcgaatcaacgcacgattcaaattgaacacattgatgcg
agcgacgtcgtgttatggaatccgtggcacaaagcgacaagtgcgatgagcgaaaccggt
tatcaaacgatggtatgcgtcgaaaccgcccgtatcaatcgaaaattacagcaaggcgat
agttttgaagtgatctttaaattagtttag

DBGET integrated database retrieval system