KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1925Help
Entry
APL_1925          CDS       T00476                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00010  Glycolysis / Gluconeogenesis
apl00051  Fructose and mannose metabolism
apl00562  Inositol phosphate metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01130  Biosynthesis of antibiotics
apl01200  Carbon metabolism
apl01230  Biosynthesis of amino acids
Module
apl_M00002  Glycolysis, core module involving three-carbon compounds
apl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_1925 (tpiA)
   00051 Fructose and mannose metabolism
    APL_1925 (tpiA)
   00562 Inositol phosphate metabolism
    APL_1925 (tpiA)
Enzymes [BR:apl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APL_1925 (tpiA)
Exosome [BR:apl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APL_1925 (tpiA)
  Exosomal proteins of bladder cancer cells
   APL_1925 (tpiA)
  Exosomal proteins of melanoma cells
   APL_1925 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABN75005
UniProt: A3N3L9
Position
complement(2161944..2162714)
Genome map
AA seq 256 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIAGLKAELADVKGCDVAIAPPVMYLAEAEAALAGQSV
IALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKECDTFIAKKFAALKA
AGLVPVLCIGETEAENEAGQTEAVCAKQIDAVIDALGVEAFNGAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRGHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLK
APAFAVIVKAAEKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccacttgtaatgggtaactggaaattaaacggtagcaaagcatttaca
aaagagttaatcgccggcttaaaagcggaattagcggatgttaaaggctgtgacgttgca
atcgcgccgccggtaatgtacttagcggaagcggaagcggcattagcgggtcaatcagtc
atcgcattaggcgcacaaaacgtagacgtaaacgtacaaggtgcatttaccggtgatatt
tcaaccgaaatgttaaaagacttcggtgcaaaatatattattatcggtcactccgagcgt
cgtacttatcacaaagaatgcgatacgttcattgcgaaaaaattcgctgcgttaaaagcg
gcgggtttagtaccggtattatgtatcggtgaaaccgaagcggaaaacgaagcgggtcaa
accgaagcggtatgcgcaaaacaaattgatgcggtaatcgatgcgttaggcgttgaagcg
tttaacggtgcggtaatcgcctacgaaccgatttgggctatcggtaccggtaaatccgca
actcctgcgcaagcgcaagcggttcacgcattcatccgcggtcacattgcagcgaaatca
caagcggttgcggatcaagtgattatccaatacggcggttcggtaaacgatgcgaatgcg
gcggaattattcactcagccggatatcgacggtgcgttagtcggcggtgcgtcattaaaa
gcgcctgcatttgcggttatcgtcaaagcggcggaaaaagcgaaagcgtaa

DBGET integrated database retrieval system