KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1959Help
Entry
APL_1959          CDS       T00476                                 

Gene name
adhI
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    APL_1959 (adhI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APL_1959 (adhI)
  Lipid metabolism
   00071 Fatty acid degradation
    APL_1959 (adhI)
  Amino acid metabolism
   00350 Tyrosine metabolism
    APL_1959 (adhI)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APL_1959 (adhI)
   00626 Naphthalene degradation
    APL_1959 (adhI)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APL_1959 (adhI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2189591..2190640
Genome map
AA seq 349 aa AA seqDB search
MMKMRAAVVAPQCDGTVEIVERDIPEIKNGEALVEVEYCGVCHTDLHVAAGDYGKKPGRI
LGHEGIGIVKSIAPDVTNLKVGDRVSIAWMFESCGSCEYCTTGRETLCRSVKNAGYTVDG
GMATHCVVTADYAVKVPDGLDPAQASSITCAGVTTYKGIKVSGVRAGQWIAIYGAGGLGN
LAVQYAKKVFGARVIAIDINDDKLAFAKEVGADLTINPLKEDSVQVIQEKVGGAHAAVVT
AVSKVAFNAAVNCVRAGGRVVAIGLPPETMDLSIPRIVLDGIEIVGSLVGTRQDLAEAFQ
FGAEGLVVPLVQLRRLDEANDIFQEMRDGKIQGRMVIDMKKGCGCGCSH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgcgtgctgctgtggttgccccacaatgtgatggaacagttgaaattgtt
gaacgtgacattcctgaaatcaaaaatggcgaagcccttgtagaagttgaatattgcggt
gtatgtcataccgatttacacgtcgctgccggtgattacggtaaaaaaccggggcgtata
ttaggtcatgaagggatcggtatcgttaaatcgatcgcaccggatgtgactaatttaaaa
gtcggtgatcgtgtcagtattgcatggatgttcgagagctgcggctcgtgcgaatattgc
actaccggacgtgaaacgctttgccgtagcgtgaaaaatgccggctatacggtggacggc
ggtatggcgacgcactgtgtcgtaacggcagattatgcggtaaaagtaccggacggtttg
gatccggcacaagcaagtagtatcacttgcgccggtgtaaccacttataaagggattaaa
gtctcgggcgtacgtgcgggacaatggattgcgatttacggtgccggcggtttaggcaac
ttggcggtgcaatatgcgaagaaagtattcggcgcacgtgtgattgcaatcgatattaat
gatgacaaactggcgtttgccaaagaagtcggtgcggatttaaccattaacccgttgaaa
gaagacagcgtacaagtgattcaagaaaaagtcggcggtgcgcatgcggcggttgtgacg
gcggtatctaaagtggcgtttaacgctgcggtgaactgcgttcgagcaggcggtcgcgtg
gtggctatcggtctgccgccggaaaccatggatctctctatccctcgtatcgtattggac
ggtatcgaaattgtcggctcgttggtcggtactcgtcaagatcttgccgaggcgttccaa
ttcggtgcggaaggtttagtagtaccgttagtgcaattacgtcgcttggacgaagcgaat
gacattttccaagaaatgcgtgacggtaaaattcaaggtcgaatggtgatcgatatgaaa
aaaggctgcggttgcggttgtagtcactaa

DBGET integrated database retrieval system