KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1988Help
Entry
APL_1988          CDS       T00476                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00860  Porphyrin and chlorophyll metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APL_1988 (hemB)
Enzymes [BR:apl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     APL_1988 (hemB)
Exosome [BR:apl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APL_1988 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABN75062
UniProt: A3N3S6
Position
2214675..2215694
Genome map
AA seq 339 aa AA seqDB search
MTQYLNTSFPTRRMRRLRKHDFSRRLVAESQLTAGDLIYPVFVIEGENQRVKVPSMPSVE
RLTIDQLLIEAGELVKYGVPAIALFPVVGNEKKSLMAEEAYNPEGLAQRAVRALKAAYPE
LGVMTDVALDPFTTHGQDGIIDEEGYVLNDITTEVLVKQAVSHAEAGADIVAPSDMMDGR
IGKIREALEAKGLINTQIMAYSAKYASNYYGPFRDAVGSAGNLKGGNKFTYQVDPANANE
GLHEVAMDIQEGADMVMVKPGMPYLDMVWRVKETFGVPTFAYQVSGEYAMHMAAIQNGWL
KERECVMEGLLCFKRAGADGILTYFAKTVAKWLYEDNRK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatatcttaacacttcatttcccactcgccgtatgcgtcgtttacgtaaacat
gatttcagccgtcgtttagtggcggaaagtcaattgactgccggcgatttaatttatccg
gtatttgtgattgaaggcgaaaatcagcgagtaaaagtaccgtctatgccgagtgtagaa
cgtttaaccatcgatcaattattaattgaagccggcgaattggtcaaatacggcgtacct
gcaatagctcttttcccagtagtaggtaatgagaaaaaatctctgatggcggaagaagcg
tataatccggaaggtttggcacagcgtgcagtacgtgcattaaaagcggcttatcctgaa
ttaggcgtgatgactgatgtggcgttagatccattcactacacacggtcaagatggcatt
attgatgaagaaggttatgtactgaatgacatcacaaccgaagtattagtaaaacaagcg
gtatctcacgcagaagctggtgcggatattgttgcaccaagcgatatgatggacggtcgt
atcggtaaaattcgtgaagcacttgaagcgaaaggcttaattaatacgcaaattatggcg
tattcggcgaaatatgcgtcaaattattacgggccgttccgtgatgcggtcggttcggcg
ggtaacttaaaaggcggtaataaatttacttatcaggttgatccggcgaatgcgaacgaa
ggtttacacgaagtggcaatggatattcaagaaggggcggatatggtgatggtaaaaccg
ggtatgccttatttggatatggtatggcgtgtaaaagaaacctttggcgtaccgactttt
gcttatcaagtatccggtgaatacgcaatgcatatggcggcgattcaaaacggctggtta
aaagaacgtgagtgcgttatggaaggtttactttgctttaaacgtgcgggagcggacggt
attttaacctatttcgctaaaacggtagcgaaatggctgtacgaagataatcgtaaataa

DBGET integrated database retrieval system