KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_2006Help
Entry
APL_2006          CDS       T00476                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:apl00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:apl00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:apl03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:apl03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2231501..2231893
Genome map
AA seq 130 aa AA seqDB search
MNIPQWVLTKPQVLKGDAQIRLDNAVKLVVVCEENHQASGLFLDILRTLQLQPNQYQWLD
AEQAQRLAFEHHPIFWLIQSELQAVEIAKKFANQTAWQHSSWKDLTNVTTKRQLWRQMAA
FYQHFEENHD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcctcaatgggtgctgacaaaaccgcaagtattaaagggcgatgcgcaaatt
cgcttggataacgcggtgaaactggttgtggtatgtgaagagaatcatcaagctagcggt
ctgtttttggatattttacgcaccttgcagttacagccgaaccaatatcaatggttggat
gcggaacaagcccagcgtttagcttttgaacatcatcctattttttggctaatccaatca
gaattacaagcggttgaaattgcaaaaaaatttgcaaatcagaccgcttggcagcatagc
tcgtggaaagatttaactaatgtcacaactaaacgccaactttggcgacaaatggcggca
ttttatcagcattttgaggaaaatcatgattga

DBGET integrated database retrieval system