KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_2020Help
Entry
APL_2020          CDS       T00476                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase (HDH)
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00340  Histidine metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01230  Biosynthesis of amino acids
Module
apl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    APL_2020 (hisD)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     APL_2020 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABN75094
UniProt: A3N3V8
Position
2247206..2248492
Genome map
AA seq 428 aa AA seqDB search
MQTLIWKNLTEQQRKEALTRPAISSSLNIQQAVDAIRENVLANGDKALFELSEKFDKVKL
DSLVVSKTQIQAASDRLSDELKQAIQNAKANIEKFHTAQIPQPVDIETQAGVRCQVVTRP
INRVGLYIPGGSAPLFSTVLMLAIPAKIAGCKKVVLCSPPPIADAILYAANLCGVETIYQ
VGGAQAIVAMAFGTETVAKVDKIFGPGNSFVTEAKRQVSQSVNGAAIDMQAGPSEVLVLA
DENADPDFVANDLLSQAEHGADSQVILVTPSETLAKQTALAIENQLAKLPRKKTACKALE
HSRIFIAESLEQAVEISNEYAPEHLVVQVENARSLLDKLDNAGSIFLGAYSPESMGDYAS
GTNHVLPTYGYTRTTSSLGLADFSKRMTVQELTPQGFKDLAKTVEVMASAEQLEAHKQAV
SIRLAKIA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctaatttggaaaaacttaaccgaacaacaacgcaaagaagcgcttactcgc
cctgcgattagctcttcgctcaatattcaacaagcggttgatgcgattcgtgaaaacgta
ttggcaaatggcgacaaggcattatttgagctttcggaaaaattcgacaaagtgaaattg
gacagccttgtcgtttcaaaaacgcagattcaagcggcaagcgatcgtttatcagatgaa
ctaaaacaggcgatccaaaatgccaaagcgaatattgaaaaattccacaccgcacaaatt
ccgcagccggtggacatcgaaactcaagcaggcgtgcgttgccaagtggtaactcgcccg
attaaccgtgtcggcttgtatatcccaggtggttcagcaccgctgttttccaccgtgcta
atgcttgctattccagcaaaaattgccggctgtaaaaaagtggtactttgctcaccgcca
ccgattgccgatgcgattttgtatgcggcgaatttgtgtggcgtggaaaccatttaccaa
gtgggcggtgcgcaagcgattgtagcaatggcattcggcacggaaacggtggcaaaagta
gataaaattttcgggccgggcaacagctttgtaactgaagccaaacgccaagtttcgcaa
agcgtaaacggtgcagcgattgatatgcaagcaggtccttcggaagtgttagtgttggcg
gatgaaaatgctgatcctgattttgtggcaaatgatttactttcccaagcggaacacggt
gcagatagccaagtgattttagtgaccccaagcgaaactttagcaaaacagaccgcactt
gcgattgaaaaccaacttgcaaaattgccgagaaaaaagacagcttgcaaagccctagaa
cacagccgaattttcattgccgaaagcctcgaacaagcggtcgaaatcagcaacgaatac
gcaccggaacatttagtagttcaagtggaaaacgcccgttctctactcgataaactcgac
aacgcaggctcaattttcttaggggcatattcgccggaaagtatgggtgactacgccagt
ggcaccaaccacgttctgccgacttacggctacacccgcactacatcgagcttaggctta
gcggatttcagcaaacgaatgaccgtgcaagaactcaccccgcaaggtttcaaagatttg
gcaaaaacggtggaagtaatggcaagtgcggaacagttggaggcgcataaacaagcggtt
tcgattcgattggcgaagattgcctag

DBGET integrated database retrieval system