KEGG   Anas platyrhynchos (mallard): 101789527Help
Entry
101789527         CDS       T02816                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101789527 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 2025 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSI
LKVTNKGLASYKDPDNPGRFSAVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQNDLANIFNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLE
SKGPPKYPSAFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSVNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TGTTQKLKPPPSSLLPPTPISGQSPSSQKSSTSTSSNSPQSSSSQSSAPSFSSLPSNSQL
KGLFDGLSHIYTAQGQSRKKGHPSYAPPKRMRRKPELSSTSKSNSHFYGKKEVRSRFISR
ACTSGWGVSRGHAFKAIAHLKRTTFLKKHRILGRLKYKVTPQMGTPSPGKGSLADGRIKP
DQDDDTEIKLSIKQENTDVFLVGSKDTVTQEDLEVFKQARELSLEKIGCKNTGETSGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIRR
EKLISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEK
EEQEIFSTRTNSRQSPAKVQSKNKYLRSPESVAVVGERGQSTEQSKESSEEDGGDENQQS
SPPRLTKPQSLTMKRKRPFLLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERP
MPQLEPTCEMDGEDDDLKPVIRKTFEYQPGQQKQEEEEEQNKEEKDIRCYRSDDNCTNNT
DDVAVLEESTKDNLEPLKSKQGWPKGVKRGPSKWRQNKERKPGFKLNLYTPPETPMEPDY
QVLVEEQKEVAEDKPCPVPAVTEEEIKEPAEGLPPPDDKVKEVEPEPLHPSSEPFEKQEN
DTVKAGEEERNVEESGIDSKDEEKDKPDEAFLQKEESVHLDDHEEEEEDDEEPSHNEDHD
ADDEDDSHMGSAEVEKEDLPGEAFKEMLETQQSFLDVNVQTGNSNQEDLMNCSVDLAADE
CESDQKEVTTDSDPVPESDDDHADNNQDQKADEELHSDFKGESSETMEIDSETVQAVQSL
TQEASEHEDTFQDCAETQEACRSLQNYAHTDQSPQMTTLDDCQQSDHSSPVSSVHSHPSQ
SVRSVNSPNVAPLENNYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSD
LGSIESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNIN
GSCSMMQQTNISSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPETGN
ANIGLYERMGQSEFGPGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASL
STPLSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTSSNIGISH
TQRLQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGRASQTVAMQGPARTLTMQRGMNMS
VNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMM
GTQPYAQQPMQTAPHSNMMYTPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6078 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaacccactttatactgagtggattcttgaagctatacaaaaagtt
aaaaagcaaaagcaacggccatctgaagagagaatatgtcacgctgtttgtgcttcccat
ggattagataagaagactgtttcggaacagctggaacttagtgttcaagatggttctatt
cttaaagttaccaacaaaggccttgcatcctacaaggacccagataatcctggacggttt
tcagctgttaagcctggcactattcctaaatctgttaagggatctagaggagcttgtaac
gagcttcgtaatgtggattggaataaactgttgagaagagcaattgaagggcttcaagaa
ccaaatggctcctccctgaaaaacatcgagaagtatctgagaagtcaaaatgacctagca
aacattttcaacaatcctgcctttcagcagagattgcgtctgggggccaaacgtgctgtg
aacaatgggagattactgaaggatggacctcagtatagagtgaattatggtggtttggaa
agcaaaggacctccaaaatatcccagtgctttcccagcttctcttccacctgtcagcctt
ctaccccatgaaaaagaccagccacgagctgatcccatcccgatatgtagcttttgtttg
ggaacgaaagaatcaaatcgtgaaaaaaaacctgaagagctgttgtcttgtgcagactgt
ggcagcagtggacatccatcatgtttgaaattctgtcctgagttaacaacaaatgtgaag
gccttaagatggcagtgtattgaatgcaagacatgcagtgcatgtaggatccaaggcaaa
aatgcagataacatgcttttttgcgactcctgtgatagagggttccacatggagtgctgt
gacccaccactttcccgaatgccaaaagggatgtggatttgccaggtctgtagaccaaag
aagaaagggagaaagctacttcatgagaaagctgcccaaataaggcgacgatatgcaaaa
cctatcggacgaccgaaaaataaactaaagcaacgaatgttgtctgtaaccagtgatgaa
ggatccgtgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggattcaagcagcagattgcct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaagggcttattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcttgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaacccccatc
tctggtcagagccccagttcacaaaaatccagcacttctacttcttctaactctccccag
agttcttccagtcagtcaagcgcaccctcctttagtagtcttcctagtaatagtcagcta
aagggactctttgatggactctctcatatctatactgctcagggacagtctcgaaaaaag
ggacacccaagctatgcaccgcccaagcgtatgcgtcgtaaaccagaattatcttctact
tcaaaatctaatagccatttctatggaaagaaagaggttaggagtaggtttatttctcgt
gcctgtacctctggatggggtgtgtctagaggacatgcttttaaagcaattgctcacctc
aagagaacaactttccttaaaaagcacaggattctaggcagattaaagtataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttggcagacggaagaattaaacct
gatcaggatgatgatactgaaatcaaactaagcatcaaacaagaaaatacagatgtattt
ctggtgggaagcaaggacacagttacgcaggaggatttggaagtatttaaacaggctcgg
gagctttccttggagaaaattgggtgtaaaaacactggtgaaacaagtgggcgatacccc
tcagtgattgagtttggaaaatatgagatacagacctggtactcttcaccttacccacag
gaatatgcaagactaccaaagctttacctgtgtgaattctgtcttaaatacatgaaaagt
aaaaacattttgttaaggcactcaaagaagtgtggctggtttcatcccccagccaatgaa
atctacagaagaaatgacctgtcagtatttgaggttgatggaaacgtgagcaaaatttat
tgtcagaacctttgtttgttagctaagctctttctggaccacaaaaccttgtattatgat
gttgaaccattcctcttctatgtccttacaaaaaatgatgagaaaggatgccatttagtt
ggatatttctcaaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgatc
atgccccaataccaaaggcaaggatttggaaggtttcttattgatttcagctatttactt
tctagaagagagggtcaagcaggatcccctgaaaagccgttgtctgatctgggtcgtctc
tcatacttggcttactggaaaagtgtaattttagaataccttaactgccaccatgaaaaa
caaatcagcatcaaaggaatgagtcgagctacgggaatgtgtccacatgatattgccaca
accctgcagcagcatagcatgatagataaaagagaagatagatttgtaattattagaagg
gaaaagctgatttcaagtcatatggagaaactgaaagcaaatccacgtattaatgaagta
gatcctgaaagcttgagatggactcctctgttagtttctaatgctgcagtttctgaagaa
gagagagaagcagaaaaggaggctgagcgtctgatggagcaagctagctgctgggaaaag
gaagagcaagaaatattctccacaagaactaatagtaggcaatcacctgcaaaagtacaa
tctaaaaataaatatttgcgatctccagaaagtgtggcagtggtgggggaacgagggcaa
tccacagaacaatctaaggagagcagcgaggaggatggtggggatgagaatcagcagagt
tcgcctccccggctgacaaagccacagtctctgaccatgaaaagaaagagacctttccta
ctgaaaaagaaaagaggccgtaaacgcagaaggattaatagcagtgttacaacagagaca
atttctgaaacaacagaggtgttgaatgagccatttgataactcagatgaggaacgtccc
atgccacagctagaacctacctgtgagatggatggggaagatgatgacttgaagcctgta
attagaaaaacttttgaatatcagcctgggcagcagaaacaggaggaagaggaagaacag
aacaaggaggagaaagacattcgttgttacaggagtgatgacaactgtacaaataataca
gacgatgtagctgtgttggaagaaagcactaaagacaatcttgaacctttaaagagtaag
cagggttggcctaaaggagttaagcgtggtccatctaaatggaggcaaaacaaagaaaga
aaacctggctttaagcttaatttatacactccacctgagactcctatggagcctgactat
caggtgctggtagaggagcagaaggaagtagctgaagataagccctgcccagtacctgct
gttacggaggaagagattaaagagcctgctgaaggattaccaccaccagatgataaggta
aaagaggtagagcctgaacctctgcatccatccagtgaaccctttgaaaaacaagaaaat
gatacggtgaaagctggggaagaagaaaggaatgtagaagaaagtggaatcgattcaaaa
gatgaagaaaaagacaagccagatgaggcttttctgcaaaaagaagagtccgtgcacttg
gatgatcatgaggaagaagaagaggatgacgaagaaccttctcacaatgaggatcatgat
gcagatgatgaggacgatagccacatgggttcagcagaagtggagaaggaggatttgcct
ggcgaagctttcaaagaaatgctggaaacacaacagtcttttttagacgtaaatgttcaa
actggtaattcaaatcaggaggacttaatgaattgtagtgttgaccttgcagctgatgag
tgtgaaagtgaccagaaagaagtaactacagattcagatccagtgccggaatctgatgat
gatcatgcagataacaaccaggaccaaaaagctgatgaagaattacattccgatttcaag
ggagagagtagtgagaccatggagattgattctgagactgttcaagcagtacagtctcta
acccaagaagcaagtgaacatgaagatacatttcaggattgtgcagagactcaagaggcc
tgtagaagtttgcaaaactatgcccataccgaccaaagcccccagatgaccacgctggat
gattgtcagcagtctgaccacagtagccctgtttcctctgtgcactctcatcccagccag
tcagttcgttctgttaatagtccaaatgttgctccattagagaacaactacgctcagatc
agcccagatcaaagtgccatttctgtgccgtctctacagaacatggagaccagtccaatg
atggatgttccctcagtttctgatcattcgcaacaagttgtggatagtgggtttagtgat
ttaggaagcattgagagtacaacagaaaactatgaaaacccaagcagttacgattctaca
atgggtagtagtatctgtggaaacaactcttcacaaaacagttgctcatacagtagcctt
acgtctagtaacctaacacagagcagctgtgcagtgacacagcagatgtccaacatcaat
ggaagctgcagtatgatgcaacaaacaaatatcagctcccctcccacttgtaatgtaaaa
tctccccaaggttgtgttgttgaaaggcctccaagcagcaaccaacagttatctcagtgc
agcatggccgctaactttacaccacctatgcagttaactgaaatccccgagactggcaat
gccaacattggcttatacgaaagaatgggtcagagcgaattcggaccggggcattactct
cagccatcggccaccttcagccttgccaaactgcagcagttaactaacacgcttatggat
cattctttgccttacagccattcagctgctgtaacttcctatgcaaacagtgcctctttg
tccacccccctaagtaatacagggcttgttcagctttctcagtctccacatgctgttcct
ggaggaccccaagcacaggctaccatgacccctccccctaaccttactcctcctcccatg
aatttgccacctccccttttgcagcgtaatatgacttcatcgaatataggaatatcccac
acccaaagactgcagactcaaatggccagcaaaggtcatgtttctgtaagaaccaaatcc
acacctctgccacctgctgcagcagctcatcagccccaaatttacgggcgtgcttcacag
actgtggccatgcaagggcccgcgcggaccttaacaatgcagcgtggtatgaacatgagc
gtaaacttgatgccagccccagcttataatgtcaattcagtgaacatgaatatgaatacc
cttaatgctatgaatggttatagtatgtcccagccgatgatgaatagcggatatcacagt
aatcatgggtatatgaatcaaacgccccagtaccctatgcagatgcagatggggatgatg
ggaactcagccatatgcacagcagccaatgcagacagcaccccacagtaacatgatgtac
acccctccagggcatcatggctacatgaatacaggcatgtctaaacagtctcttaatggc
tcctacatgcgaaggtag

DBGET integrated database retrieval system