KEGG   Anas platyrhynchos (mallard): 101789855Help
Entry
101789855         CDS       T02816                                 

Gene name
GPD1
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 1
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101789855 (GPD1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101789855 (GPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C F420_oxidored DUF643
Motif
Other DBs
NCBI-GeneID: 101789855
NCBI-ProteinID: XP_005021619
Ensembl: ENSAPLG00000006844
UniProt: R0JR24
Position
Un
AA seq 349 aa AA seqDB search
MGGKKVCIVGSGNWGSAIAKIAGSNAARLSTFENLVSMWVLEEEVGGRRLTEIINTEHEN
VKYLPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCEQLKGHVKKDAIGMSLIK
GVDEGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCKNAQYGQILKEL
MQTPNFRVTVVQEADTVEICGALKNIVAVAAGFCDGLGFGDNTKAAVIRLGLMEMIGFAK
LFCKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTGKSIEQLEKEMLNGQKLQGP
QTSAELHRILKSKNMVEKFPLFTAVYQICYEGKPVTDVIKCLQNHPEHM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagaaagtgtgcatcgtgggctcgggcaactggggctcggccatcgccaag
atcgcgggcagcaacgcggcgcggctgagcaccttcgagaacctggtgagcatgtgggtg
ctggaggaggaggtgggcggccggcggctcaccgaaatcatcaacacggagcacgagaac
gtcaaatacctgccgggacacaagctgccccccaacgtggtggcagagccagacctgctg
aaagcctgcgccggggccgacgtcctcctgttcgtggtgccccaccagttcatcggcaag
gtgtgcgagcagctcaagggccacgtgaagaaagatgctatcgggatgtcgctcatcaag
ggggtggacgaaggaccagatgggctgaggctgatctcagacattatccacgagaagctg
ggaatcgagatgagcgtcctcatgggggccaacatcgctaacgaagtggcagaagagaag
ttctgcgaaacaaccatcgggtgcaagaacgcgcagtacgggcagatcctgaaggagctg
atgcagacaccgaatttccgcgtcacggtggtgcaggaggctgacaccgtagagatctgt
ggggccctgaagaacatcgtggctgtagcggctggtttctgtgatgggctcggcttcggg
gacaacacgaaggctgcggttatccggctgggactgatggagatgatcggcttcgccaaa
ctcttctgcaagggccccgtcaccccctccaccttcctggagagctgcggggtggctgat
ctcatcactacctgctacggcggtcgcaaccgcaaggtggctgaggcttttgccaagact
gggaagtctattgagcagctggagaaggagatgttgaacgggcagaagctgcagggtccc
cagacgtctgccgagctgcatcgcatcctcaaaagcaagaacatggtggagaagttcccc
ctcttcacagctgtatatcagatctgctacgagggcaaacctgttaccgatgtcatcaag
tgtctccagaaccaccccgagcacatgtaa

DBGET integrated database retrieval system