KEGG   Anas platyrhynchos (mallard): 101789855Help
Entry
101789855         CDS       T02816                                 

Gene name
GPD1
Definition
glycerol-3-phosphate dehydrogenase 1 (soluble)
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101789855 (GPD1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101789855 (GPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 349 aa AA seqDB search
MGGKKVCIVGSGNWGSAIAKIAGSNAARLSTFENLVSMWVLEEEVGGRRLTEIINTEHEN
VKYLPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCEQLKGHVKKDAIGMSLIK
GVDEGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCKNAQYGQILKEL
MQTPNFRVTVVQEADTVEICGALKNIVAVAAGFCDGLGFGDNTKAAVIRLGLMEMIGFAK
LFCKGPVTPSTFLESCGVADLITTCYGGRNRKVAEAFAKTGKSIEQLEKEMLNGQKLQGP
QTSAELHRILKSKNMVEKFPLFTAVYQICYEGKPVTDVIKCLQNHPEHM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagaaagtgtgcatcgtgggctcgggcaactggggctcggccatcgccaag
atcgcgggcagcaacgcggcgcggctgagcaccttcgagaacctggtgagcatgtgggtg
ctggaggaggaggtgggcggccggcggctcaccgaaatcatcaacacggagcacgagaac
gtcaaatacctgccgggacacaagctgccccccaacgtggtggcagagccagacctgctg
aaagcctgcgccggggccgacgtcctcctgttcgtggtgccccaccagttcatcggcaag
gtgtgcgagcagctcaagggccacgtgaagaaagatgctatcgggatgtcgctcatcaag
ggggtggacgaaggaccagatgggctgaggctgatctcagacattatccacgagaagctg
ggaatcgagatgagcgtcctcatgggggccaacatcgctaacgaagtggcagaagagaag
ttctgcgaaacaaccatcgggtgcaagaacgcgcagtacgggcagatcctgaaggagctg
atgcagacaccgaatttccgcgtcacggtggtgcaggaggctgacaccgtagagatctgt
ggggccctgaagaacatcgtggctgtagcggctggtttctgtgatgggctcggcttcggg
gacaacacgaaggctgcggttatccggctgggactgatggagatgatcggcttcgccaaa
ctcttctgcaagggccccgtcaccccctccaccttcctggagagctgcggggtggctgat
ctcatcactacctgctacggcggtcgcaaccgcaaggtggctgaggcttttgccaagact
gggaagtctattgagcagctggagaaggagatgttgaacgggcagaagctgcagggtccc
cagacgtctgccgagctgcatcgcatcctcaaaagcaagaacatggtggagaagttcccc
ctcttcacagctgtatatcagatctgctacgagggcaaacctgttaccgatgtcatcaag
tgtctccagaaccaccccgagcacatgtaa

DBGET integrated database retrieval system