KEGG   Anas platyrhynchos (mallard): 101790190Help
Entry
101790190         CDS       T02816                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101790190
Peptidases [BR:apla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101790190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWAVACLALASAVSGCGVPSISPSVQYNERIINGQNAVSGSWPWQVSLQRYGNFHFC
GGSLISEQWVVTAAHCGVKTTDAVVLGEYDQETESGDVQRLSIAKXXRNPSYSSLTVRND
ITLIKLATPAQLNARVSPVCLPQATDDFPGGLTCVTTGWGLTDASGTAAPAVLQQVALPL
LTNAQCKQYWGYRIYDVMVCAGADGASSCMGDSGGPLVCQKDGAWTLVGIVSWGSSSCST
SMPAVYARVTELRAWIDSILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttctctgggcagttgcctgcctggccctcgccagcgccgtctcaggctgtggg
gtgccctcgatcagcccctcggtgcagtacaacgagaggatcatcaacgggcagaatgcg
gtgtccggctcctggccctggcaggtgtccctgcagcgctacggcaacttccacttctgc
ggcgggtccctgatcagcgagcagtgggtggtcaccgctgcccactgcggcgtcaagacc
actgacgccgtggtgctgggcgagtacgaccaggagaccgagtccggggacgtgcagagg
ctgtccatcgccaagnnnnnccgcaaccccagctacagctcgctgaccgtccgcaacgac
atcacgctgatcaagctggccaccccggcgcagctgaacgcccgcgtgtcccccgtctgc
ctgccccaggccaccgatgacttccccgggggcctcacctgcgtcaccacgggctggggg
ctcaccgacgcctcgggtaccgcggccccggcggtgctgcagcaagtggccctgcccctg
ctgaccaacgcgcagtgcaagcagtactgggggtaccgcatctacgacgtgatggtgtgc
gccggcgctgacggagcctcctcctgcatgggcgactccgggggcccgctggtgtgccag
aaggacggcgcctggaccctggtgggcatcgtctcgtggggcagcagcagctgctccacc
tccatgcccgccgtgtacgcccgcgtcaccgagctgcgcgcctggatcgactccatactg
gcggccaactga

DBGET integrated database retrieval system