KEGG   Anas platyrhynchos (mallard): 101790208Help
Entry
101790208         CDS       T02816                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:apla01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:apla01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:apla03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MLHPRAGLRPSPPLLSVPAAYFCFLVTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSM
AFQNDIYEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDFTD
LLDDPVVRFQRKYYKSSVVLMCFVIPTFVPWYLWGESLWNAYFLASILRYTISLNVTWLV
NSAAHMYGNRPYDKYINPRQNTFVTLGAIGEGFHNYHHTFPFDYSASELGLKFNPTTWFI
DFMFWLGLVTDRKQAPKEMIQARKERTGDGSA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcccagggctgggctgagaccctcccctcctctcctgagcgtccctgcagcc
tatttctgtttcctggtgacagccctgggtgtgacggctggggcgcatcgcttgtggagc
caccgttcctacaaggccaagctgcctctgcggatcttcctggctgcagctaactccatg
gctttccagaatgacatctacgagtggagccgagaccaccgcgtgcaccacaagtactcg
gagacggacgcagacccgcacaacgcccgccgtggcttcttcttctcccacatcggctgg
ctgttcgtgcgcaagcaccgggacgtcattgagaaggggagaaaactggatttcactgac
ctgctggacgaccccgtcgtcaggttccagagaaagtattacaagagctcggtcgtgctg
atgtgctttgtgatccccacctttgtgccgtggtacctctggggcgagagcctgtggaat
gcctacttccttgcctccatcctccggtacaccatctccctcaacgtcacctggctggtc
aacagcgccgcgcacatgtacggcaaccgtccctacgacaagtacatcaaccccaggcag
aacacctttgtcactctgggagccattggtgagggtttccacaactaccaccacaccttc
cccttcgactactccgccagcgagctgggcctgaagttcaaccccaccacctggttcatt
gacttcatgttctggttggggttggtcaccgaccgaaagcaggctccgaaggagatgatc
caggcgcgcaaggaaaggactggagatggcagcgcttga

DBGET integrated database retrieval system