KEGG   Anas platyrhynchos (mallard): 101790670Help
Entry
101790670         CDS       T02816                                 

Definition
(RefSeq) fatty acyl-CoA hydrolase precursor, medium chain-like (EC:3.1.2.-)
  KO
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101790670
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101790670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 557 aa AA seqDB search
MATEKNTLLSLILTAGITALVATGQKAEQPEVVTNYGSVRGYQVKVNAAERSVNVFLGLP
FAKPPVGPLRFSEPQPPEPWKGVRDAASYPPMCLQDKVLGQYLSDAITNRKEKVRLQISE
DCLYLNVYTPVSTEEQEKLPVFVWIHGGGLVSGAASSYDGSALAAFDNVVVVTIQYRLGI
AGYFSTGDKHARGNWGYLDQVAALQWIQENIIHFRGDPGSVTIFGESAGGVSVSALVLSP
LAKGLFHKAISESGTAVRILFTEQPEEQAQRIAAAAGCEKSSSAALVECLREKTEAEMEQ
ITLKMPPMFISASLDGVFFPKSPRQLLSEKVINAVPYIIGVNNCEFGWILPRMMKFPEFT
EGLEKDVARQVLQSTLALSFKGAPSDIVDLVYNEYIGVAENRAQVRDGLLDSIADPLFVF
SAVEVARHHRDAGNPVYFYEFQHRPSSAAGVVPEFVKADHADEIAFVFGKPFLAGNATEE
EAKLSRTVMKYWTNFARNGNPNGEGLVHWPQYDMDERYLEIDLTQKAAKKLKERKMEFWM
QLTEQIMSDRRRKHTDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaaagaacacgctgctgtccttaattctcactgctgggattacagcactt
gtagctactggacaaaaagcagaacaaccagaagtggtgaccaactatgggagtgtccga
gggtaccaagtcaaagtaaatgcagccgagaggagtgtcaatgtctttctgggacttcct
tttgctaagcctcctgttggaccattaaggttttctgaaccccagccacctgagccatgg
aaaggtgtcagagatgctgcttcctacccaccaatgtgtctacaggacaaagtattagga
cagtatctttcagatgctattactaacagaaaagaaaaagttcgtctccaaatatctgaa
gattgcttatatctgaatgtatacacacccgtttctacagaagaacaggagaagctgcct
gtctttgtatggatccatggaggtggattagtttctggagcagcttcatcatatgatggt
tcagcactagcagcctttgacaatgtggtagttgtaacaattcagtacagattaggtatt
gctggatattttagcacgggtgataagcatgctcgtggtaactgggggtatttggatcaa
gtagcagctctccagtggattcaggaaaatatcatacattttagaggagatccaggatct
gtcaccatttttggagaatctgcaggaggagtcagtgtttctgctcttgtcttatctcct
ctggcaaagggcttgttccataaggccatttcagagagtggtactgcggtcaggattttg
ttcactgagcagcctgaggagcaagcacagagaattgctgctgcagctggctgtgaaaaa
tccagttcagctgcattggttgagtgcttaagagaaaaaactgaggcagagatggaacag
ataactctaaaaatgcctcccatgttcatcagtgcatctctggatggcgtatttttccct
aagagtcccaggcaattgctatctgaaaaagtgatcaatgcagtcccatatataatagga
gtaaataactgtgaatttggatggatacttcctagaatgatgaaatttcctgaatttaca
gaaggtctggagaaagatgttgcacgtcaagtgttacagagcacattagcattatcattt
aagggtgctccttctgacattgttgatctagtatacaatgaatacataggggttgcagag
aaccgtgctcaggtgcgagatggccttcttgattcaatagcagatcctttgtttgttttt
tcagctgttgaagtggctagacaccacagagatgctggcaacccagtctacttttatgaa
ttccagcatcgaccaagctcagctgcaggtgttgtaccggagtttgtaaaagcagatcat
gcagatgagattgcctttgtctttggaaagccattcttagctgggaatgctacagaagaa
gaagcaaaacttagcagaactgttatgaaatattggactaactttgctagaaatggaaat
cccaatggagaaggcttggtacattggcctcaatatgatatggatgaaagatacctggaa
atagacctgacacaaaaggcagcgaagaaattgaaagaacgtaaaatggagttttggatg
cagcttacagaacaaataatgagtgacagaagaagaaaacacacagatttataa

DBGET integrated database retrieval system