KEGG   Anas platyrhynchos (mallard): 101790851Help
Entry
101790851         CDS       T02816                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:apla00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 358 aa AA seqDB search
MVMQLDNVIITNHSSLCRGGLSNMLFQCSLPDTIETVADEPRKVLLRLYGAILQMRSCNK
GESVQSQKENDLQGAEAMVLESVMFAILAERALGPKLYGIFPQGRLEEFIPSRKLSTEEL
SLPDISAEIAEKMARFHGMKMPFNKEPKWLFGTMEKYLNQVLRIKFTRESKTRKLNKLLS
YNLPQEMKNLRAMLEATPSPVVFCHNDCQEGNVLLLEGRENSEKQKLMLIDFEYSSYNYR
GFDIGNHFCEWMYDYTYEKYPFFKASVLKYPSKKQQLHFISSYLSAFHDGFENLSNEEKF
KLEEEMLIEVNRFALASHFFWGLWSIIQAKISSIEFGYLEYALSRFDAYFDQKKKLKV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgcagctagacaacgtaataatcactaatcactcttctctttgcagaggtggc
ctcagcaacatgctgtttcagtgctctctacccgataccattgagacagttgcagacgaa
ccacggaaagttctcctgcgcttatatggtgcaatcctgcagatgaggtcctgtaataaa
ggagagtctgtacagtctcagaaggaaaatgacttgcaaggggcagaagccatggttttg
gaaagtgttatgtttgccattcttgcagagagagctcttggtccaaagctgtatggaatc
tttccacaagggcgactggaggaatttattcccagcaggaaactaagtactgaggaacta
agcttacctgacatatccgctgaaatagctgagaagatggctagatttcatggcatgaaa
atgccatttaataaagaaccgaagtggctttttgggacaatggaaaagtatctaaatcaa
gtgctgaggatcaaatttaccagggaatccaaaactaggaaactgaacaaactcctcagt
tacaatctaccccaggaaatgaaaaatctgagagctatgcttgaagctactccatcaccg
gttgtattttgccacaatgactgtcaggaaggtaatgtcttgcttctggaaggcagagag
aattcagaaaaacaaaagctgatgctcattgactttgaatacagcagctataattaccga
ggttttgacattggaaatcacttctgtgaatggatgtatgattacacgtatgagaagtat
ccattcttcaaagctagcgttctgaaatatccttcaaagaagcaacagcttcactttatt
tccagttacctgtctgcattccatgatggctttgaaaatctgagcaatgaagagaagttc
aagctagaagaggaaatgttgatagaagttaacaggtttgcccttgcatcacacttcttc
tggggtctgtggtctattatacaagcaaagatctcatccattgaatttggttacctggaa
tatgcattatccagattcgatgcatactttgatcagaagaagaagctgaaggtgtga

DBGET integrated database retrieval system