KEGG   Anas platyrhynchos (mallard): 101791473Help
Entry
101791473         CDS       T02816                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101791473 (NCOA1)
Chromosome [BR:apla03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101791473 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1247 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTAQSNEKRRREQENKYLEELAELLSANIGDIDTLS
VKPDKCKILKKTVDQIQQMKRLEQEKAADDEVQKSDISSSSQGVIEKESLGPLLLEALDG
FFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVP
WPQEATRRNSHTFSCRMLIRPPDEPGAENQEARQRYEVMQCFTVSQPKSFKEEGEDFQSC
LICIARRLPRPAAVAPSESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPSSPEMQPFIMGIH
VIDRDHGMLSPQENTNSAMALPRVSPSLNPSISPGQGMALPPSIPPSNAAAPACNQQQQP
GPGLHSSNSSSSQSSFGCSPGNQIGANVALSQGQAGPQNSNHTLNLNSSPXXXXXTPPQF
MSPRHRVSPGLVPRPRGPSNPFSTSHKLVQLLATTAEQQLRHADADTSCKDSLACAGAPG
ALAAGNPPSSTCPSSHSSLTERHKILHRLLQEGSPSDITTLAMEHEKKDSIPVPNPATTP
TAPSQLPGNPEIKLEPEALKKKDVKDHQLLRYLLDKDEKELAAAXXXXXXXXXXKVEKTE
QMEPCNTAPVPLAKPPAAEEVKLESQGQFAAELEQLDQLLPSLEKAAQLPGLCGPERSES
GVAVKPEMLTAPLQPSAAARAPAGLNPLSSGQGVQPARAPFEFCDPLEPAQLRPVAFPAT
NGSSPRPRAPAEQGRGTVTGPNPFPPDTGMSELEMGVPDHQFGQPGMGEQLPWTESSMAP
MNRGALSKPDDPCITSQLDELLCPPTTPEGRNDEKALLEQLVSFLSGKDETELAELDRAL
GIDKLVQVEGGEKGFGAAGVGRRGAKMRAKEDFQHLPTGGQMSQQHRQRQLMQQRALLMR
QQSFGNNAARLPQAPPQQFPYPPNYGTSPGNPPTSTSPFSQLASSPEAALANRGAMVNRG
MMGGVGGQFGAGMTPQMQQNIFQYSGSGMGQQNEPAFAPSLSPSSPLMSPQLPPSQSPML
QPAPPTPGYQSPDMKSWQQGAMGNSNVFSQTGQTQPAPAQQGMYNNMSITVSMAGGNTNV
QNINPMAGQMQMNSLQMPGMNSMCSEQVNDPALRPAGLYCNQLSSTDLLKTEADGAQVSK
KLLSTSQVQRGVGRAPKIQPSRPCRGAALGTGQDFGCGQLWLTGLAS
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccttggggacagctcaacggaccctgccaaccccgactcgcggaagaggaaa
ggctcgccctgcgacacggcccagagcaatgagaagcggcgtcgggaacaggagaacaaa
tatttagaggagctggcggagctgctgtctgcaaacatcggggacatcgacaccctgagt
gtcaaaccagacaaatgcaagatcctgaagaagacggttgaccagatccagcagatgaag
aggttggagcaagagaaagcggccgatgatgaagtccagaagtccgacatctcctccagc
agccagggagtgattgagaaggagtcgctgggacctcttctgctggaggcgttggacggc
ttcttcttcgtcgtgaaccgcgaggggaggatcgtcttcgtctccgagaacgtcaccagc
tacctgggctacaaccaggaggagctcatgaacaccagcgtctacagcatcctgcacgtg
ggggatcacgccgagttcgtcaagaatttgttgcccaaatcgctagtaaacggagttcct
tggcctcaagaagcgacgcggcgcaacagccacaccttcagctgcaggatgctgatccgg
ccgcccgacgagccgggcgcggagaaccaggaggctcgccagcgctacgaggtgatgcag
tgcttcaccgtgtcccagcccaagtccttcaaggaggaaggagaagatttccagtcatgc
ctgatctgcatcgcgaggagattaccccgaccagcagccgtcgccccttccgaatccttc
gtgaccaagcaagacaccacaggtaaaatcatctccatcgacaccagctccctgagagcc
gccggcaggacgggctgggaggatttagtgcggaaatgcatctacgctttcttccagccc
cagggcagagagccatcttacgccaagcagctatttcaagaagtgatgacccgcggcacg
gccttcagcccctcgtaccggttcaccctgagcgacggcacggtgctcagcgcccacacc
aagtgcaagctctgctacccctccagtcccgaaatgcagcccttcatcatgggcatccac
gtcatcgacagggatcacggcatgctgtctccccaggagaacactaactcggcgatggct
ctgccccgggtcagcccctcgctgaaccccagcatctccccggggcaaggcatggccctg
cctccctccatccctccctccaacgctgctgcccctgcctgcaaccagcagcagcagccc
ggccccggcctccacagcagcaactccagcagcagccaaagcagctttgggtgttcgcct
gggaaccagatcggagccaacgttgccttaagccagggacaagccggtccccagaacagt
aaccacactttaaacctcaatagctcccccnnnnnnnnnnnnnnnaccccgccgcagttc
atgtctcctaggcaccgggtcagcccgggactggtaccccgacccaggggacccagcaat
cctttttccaccagccacaagctggtccagctgctggccaccacggcggagcagcagctt
cggcacgccgacgcggacacgagctgcaaagattcgctcgcctgcgccggtgcccccggc
gctttggccgccggcaaccctccgagcagcacctgcccctcctcgcatagctcgctgacc
gagcggcacaagattttgcatagactccttcaggagggcagcccttcggacattaccacc
ctggccatggagcacgagaaaaaggacagcatccccgtccccaaccccgccaccaccccc
acggctccgagccagctcccgggcaacccagaaatcaagctggagccggaggcgctgaag
aaaaaagatgtcaaggatcaccagctcctgcgttatctgctcgacaaggacgagaaggag
ctcgccgctgctcnnnnnnnnnnnnnnnnnnnnnnnnnnnngaaggtggagaagacggag
cagatggagccctgcaacaccgccccggtgccgctggccaagcctccggccgcggaggag
gtgaagctggagtcccagggccagtttgctgccgaactggagcagctggaccagctcctg
ccgtcgctggagaaagcagcccagctgccgggcttgtgcgggccggagaggagcgagagc
ggcgtggccgtcaaacccgaaatgctgacggcccctctgcagcccagcgccgccgccaga
gcccccgccggactcaaccctctgagcagcgggcagggcgtgcagcctgctcgggctccc
ttcgagttctgcgaccctctggagccggctcagctcagacccgtggctttccctgccacc
aacggcagcagcccgcggccccgcgcgccggccgagcagggcaggggcacagtgacggga
ccaaaccccttccctcccgacacaggaatgtctgagctggagatgggggtgccggatcac
cagtttggacagccgggcatgggggagcagctcccgtggacggagagcagcatggcaccc
atgaatcgaggcgctctgagtaaacccgatgacccctgcatcacctcgcagctggacgag
ctcctgtgtcctcccaccacgccggagggtcgcaacgacgagaaagccctgctcgagcag
ctcgtgtccttcctgagcggcaaagacgagacggagctggccgagctggaccgagccctt
ggcatcgacaaactggtgcaggtagaggggggagaaaaagggtttggggctgctggggtt
gggcggaggggggccaagatgagggcgaaggaggatttccagcatctgccaacgggaggc
cagatgagccagcagcaccggcagcggcagctgatgcagcagcgagccctcctgatgaga
cagcagagcttcggcaacaacgccgcccggcttccccaagcccccccgcagcagttccct
tatccccccaactacggtacgagccccgggaacccccccacctccaccagccccttctcg
cagctggcgtccagccccgaggccgcgctggcgaaccgcggcgccatggtcaacaggggg
atgatgggcggcgtcggcgggcagttcggcgccgggatgaccccgcagatgcagcagaac
atctttcagtattcgggttcaggcatggggcagcaaaacgagcccgccttcgccccctcg
ctcagccccagcagccccctgatgtcgccgcagctccccccgtcgcagagccccatgctg
cagccggcgccgccgaccccgggctatcagtcccccgacatgaagagctggcagcaagga
gccatgggcaacagcaacgtgttcagccaaaccgggcagacgcagccggccccggcgcag
caggggatgtacaacaacatgagcatcaccgtctccatggcaggagggaacaccaacgtc
cagaacatcaaccccatggcgggccagatgcagatgaactcgctgcagatgcccgggatg
aactccatgtgctcggagcaggtaaatgacccggcgctgagacccgcgggcctttactgc
aaccagctttcctccactgaccttttgaaaacagaagcagacggggcgcaggtcagtaag
aaactgctaagcacatctcaggtacagagaggagttggccgtgctcccaaaattcagcca
tcccggccgtgccgtggcgccgcgctcggcaccgggcaagattttggctgtggccagctc
tggctcacggggctggcctcctag

DBGET integrated database retrieval system