KEGG   Anas platyrhynchos (mallard): 101791501Help
Entry
101791501         CDS       T02816                                 

Definition
(RefSeq) alkaline phosphatase, tissue-nonspecific isozyme-like
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101791501
   00790 Folate biosynthesis
    101791501
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101791501
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101791501
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:apla00537]
 Enzymes
  101791501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 141 aa AA seqDB search
MDKFPYVALAKXYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAGVTRDRCNTTKGQEVT
SILRWAKDEGKAVGIVTTTRVTHATPSAAYAHSANRDWYSDGEMPPDAXXGWLQGHRAAA
GGEHPRHRGGHGAGDTPREEV
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttcccctacgttgccttggccaagncctacaacaccaacgctcaggtgccc
gacagcgcgggcacggccaccgcctacctctgcggtgtcaaagccaacgaggggacggtg
ggcgtcagcgccggcgtcacccgcgaccgctgcaacaccaccaagggccaggaggtgacc
tccatcctccgctgggccaaggatgaaggcaaggcagtgggcatcgtcaccaccacgcgg
gtcacccacgcgacgcccagcgccgcttacgcccactctgccaaccgcgactggtactcg
gatggagagatgcccccggatgcgcnnnnngggtggctgcaaggacatcgcgcggcagct
ggtggagaacatccccgacatcgaggtgggcacggggctggggacaccccgagggaagag
gtgtga

DBGET integrated database retrieval system