KEGG   Anas platyrhynchos (mallard): 101791664Help
Entry
101791664         CDS       T02816                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101791664 (ELP3)
Transfer RNA biogenesis [BR:apla03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101791664 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 555 aa AA seqDB search
MATESTETLRQMERDLSHAELMMMTIADIIKQLIEAHEQGKDVNLNKLKTKTSAKYGLSA
QPRLVDIIAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCP
GGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGT
FMALPEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSLTKCIGITIETRPDYCLKRHLS
DMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMG
LERDTDQFVEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVARIL
ALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHH
KVRPYQIELVRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSEESFRPELKGGVSIVR
ELHVYGSVVPVSSRDPSKFQHQGFGMLLMEEAERIAKEEHGSWKIAVISVTEVQNFLKVN
LMHHTGVKPTCKGER
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaagcacggagaccttgcggcaaatggaaagagatctcagccatgcggaa
ctgatgatgatgacaatagctgacatcataaaacaattaattgaagctcacgagcaggga
aaagacgtgaatctgaacaagctgaaaaccaagacttcagccaagtatgggctctcggcg
cagccacgtctggtcgacatcatcgctgccgttccgccgcagtaccgcaaggtgctggtg
ccaaagctgaaggccaagcccataaggactgcgagcgggattgctgtcgtggccgtgatg
tgtaaaccacacaggtgtccacacattaactttacgggcaacatatgtgtgtactgccca
ggtgggcctgattctgacttcgagtattcaacgcagtcttacactggatatgagccaaca
tccatgagggccattcgggctaggtatgacccctatctccagacaagacacagagtggaa
cagctgaagcagctgggccacagcgtggataaagtggagttcatcgtgatgggaggaacc
ttcatggctctgcctgaagactaccgagattacttcatcagaaaccttcacgacgccttg
tcgggtcacacttccaataatgtagcagaagctgtcaggtactcggaacgaagcctgaca
aaatgcatcgggataacaatagagacccggcccgattactgcctgaagcggcatctcagt
gacatgctgtcctacggctgcacgaggctggagattggcgtgcagagcgtctacgaggac
gtggccagggacaccaacagaggtcacaccgtgaaggctgtgtgcgagtcgtttcaccta
gccaaggatgctggcttcaaagtggtggcgcacatgatgcccgacttaccaaacatgggg
ctcgaaagggacacggaccagtttgttgagttttttgagaatcctgcttttcgcccggac
ggcatgaagctctatccaacgctagtgatccggggcactggtctgtacgagctgtggaag
acggggagatacaagagctacccccctagcactctggtggatctggtggccagaatcttg
gctctcgtccctccgtggacacgtgtgtaccgtgttcagagagatattccgatgccacta
gtgagctccggagtggagcacgggaacctgagagagcttgccttggccaggatgaaagat
cttgggacacagtgtcgtgacgtaaggacaagagaggttggaattcaagaaattcaccat
aaagtgagaccgtatcagattgaattggttaggagagattacgtggctaatggtggctgg
gagaccttcctgtcctatgaagacccagaacaggacattctcgttggccttctacgactg
cggaagtgttcagaggagtccttcagacctgagctgaaaggaggtgtttccatcgtccgg
gagctgcacgtgtatgggagcgtggtcccagtgagcagccgggatccttcaaaatttcag
caccagggatttggtatgttgctcatggaggaggcagagagaatagccaaggaggagcat
gggtcatggaaaattgctgtaatttcagttacagaggttcagaactttctaaaagtaaat
ctgatgcatcacaccggtgttaaacccacctgcaagggagagcgttaa

DBGET integrated database retrieval system