KEGG   Anas platyrhynchos (mallard): 101792808Help
Entry
101792808         CDS       T02816                                 

Gene name
MAOB
Definition
monoamine oxidase B
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101792808 (MAOB)
   00330 Arginine and proline metabolism
    101792808 (MAOB)
   00340 Histidine metabolism
    101792808 (MAOB)
   00350 Tyrosine metabolism
    101792808 (MAOB)
   00360 Phenylalanine metabolism
    101792808 (MAOB)
   00380 Tryptophan metabolism
    101792808 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101792808 (MAOB)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101792808 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 541 aa AA seqDB search
MLDQIPVLGQVAEVVQPYIAIQIGFAQFLIVSFLSGLSAAKLLTESGLNVVLLEANDRVG
GRTFTVRNKQVKYVDLGGAYVGPTQNRLLRLSKELGIETYKVNEVEHLIHHVKGKSYPFK
GAFPPLWNPLAYLDYNNLWRTMDEMGKEIPNEAPWKAPHAEEWDKMTMQDFIDKICWTNA
AKSFATLFVNVDVTSEPHEVSALWFLWYVKQCGGTARIFSTTNGGQERKFVGGSGQISEK
IMERLGSRVKLRKPVVRIDQSGENVVVETLDHELYEGKYVISAIPPALGLKIHFNPPLPP
MRNQLINRIPMGSVIKCIVYYKETFWRKKGYCGTMMIEDEDAAIGLTLDDTKPDGSFPAI
IGFILARKCRRLTNLTKEERKTRLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCYTA
YFPPGIMTQYGRILRQPVGRIYFAGTETATEWSGYMEGAIQAGERAAREILFAMRKIPES
EIWKPEPESIDVPALPITTTFWERNLPSVPGLIKLIGFSTVFTSVAVAGLFAYKKGLLVR
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctggaccaaattcctgtcctcggccaagtggcagaagtggtccagccttacattgca
attcagatcgggtttgcccaatttttaattgtttcttttctttcaggtctctcggcagcc
aaactgctgactgagtcaggcttgaatgtggtgctgctggaagccaatgacagggttggg
ggaagaactttcaccgtaaggaataagcaagttaaatatgtggaccttggaggagcctat
gtggggccaacacagaatcgtctcctgcggttgtctaaggagttgggaatagagacatat
aaagtgaatgaagttgagcacctgatacaccatgtcaagggtaagtcttaccccttcaaa
ggtgcattccctcctctgtggaatcctttggcctacctggactacaacaacctgtggagg
accatggatgaaatgggaaaggagattcctaatgaagctccatggaaggctccacatgca
gaagaatgggacaaaatgactatgcaagatttcatagacaaaatttgctggacaaatgct
gccaagagttttgcaactctgtttgtgaatgtggatgtcacttctgaaccccacgaggtc
tctgccctctggtttttgtggtatgtgaagcagtgtggggggacagccaggatcttctca
acaaccaatggagggcaggagagaaagtttgttggaggctctggacagatcagtgagaaa
ataatggagcgcctaggaagccgagtgaaactgaggaagccagtagttcgcattgaccag
tcgggtgaaaacgtcgtagtggaaaccttagatcatgaattatatgagggcaaatatgtg
atcagtgccattcccccagctcttggtttgaagattcatttcaacccacctttgccccca
atgagaaaccagctcatcaaccgaatcccaatgggctcagtcatcaaatgcatcgtgtac
tacaaggaaaccttctggaggaagaaggggtattgtggtaccatgatgattgaggacgag
gatgctgcaattggtttaacacttgatgatactaagcctgatggtagctttcctgccata
ataggtttcattcttgctcgaaagtgtagaagactgacaaatctcacaaaagaagaaagg
aaaacgaggctgtgtgagctctatgcaaaggttctgggatcagaggaagctttacatcca
gtacattatgaagagaagaactggtgtgaagagcagtattctggaggatgctacacagcc
tacttcccaccaggcataatgactcagtatggaaggattcttcggcagcccgttggcagg
atctactttgctggcacagagacagccacagagtggagcggatacatggagggggccata
caggctggagaaagagcagccagagagatactgtttgctatgaggaaaatcccagaaagt
gaaatatggaagccagaacctgaatcaattgatgttccagctttgcccatcactacaacc
ttttgggagaggaacttgccatctgtgccaggactgataaagctgattggattttccact
gtattcacctctgtggctgtggcagggttatttgcctacaaaaaaggacttctggttcga
aactga

DBGET integrated database retrieval system