KEGG   Anas platyrhynchos (mallard): 101792808Help
Entry
101792808         CDS       T02816                                 

Gene name
MAOB
Definition
(RefSeq) amine oxidase [flavin-containing] B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00260  Glycine, serine and threonine metabolism
apla00330  Arginine and proline metabolism
apla00340  Histidine metabolism
apla00350  Tyrosine metabolism
apla00360  Phenylalanine metabolism
apla00380  Tryptophan metabolism
apla00982  Drug metabolism - cytochrome P450
apla01100  Metabolic pathways
Module
apla_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101792808 (MAOB)
   00330 Arginine and proline metabolism
    101792808 (MAOB)
   00340 Histidine metabolism
    101792808 (MAOB)
   00350 Tyrosine metabolism
    101792808 (MAOB)
   00360 Phenylalanine metabolism
    101792808 (MAOB)
   00380 Tryptophan metabolism
    101792808 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101792808 (MAOB)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101792808 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 101792808
NCBI-ProteinID: XP_012948400
Ensembl: ENSAPLG00000012540
UniProt: U3IYQ3
Position
Un
AA seq 520 aa AA seqDB search
NQFLAQFLIVSFLSGLSAAKLLTESGLNVVLLEANDRVGGRTFTVRNKQVKYVDLGGAYV
GPTQNRLLRLSKELGIETYKVNEVEHLIHHVKGKSYPFKGAFPPLWNPLAYLDYNNLWRT
MDEMGKEIPNEAPWKAPHAEEWDKMTMQDFIDKICWTNAAKSFATLFVNVDVTSEPHEVS
ALWFLWYVKQCGGTARIFSTTNGGQERKFVGGSGQISEKIMERLGSRVKLRKPVVRIDQS
GENVVVETLDHELYEGKYVISAIPPALGLKIHFNPPLPPMRNQLINRIPMGSVIKCIVYY
KETFWRKKGYCGTMMIEDEDAAIGLTLDDTKPDGSFPAIIGFILARKCRRLTNLTKEERK
TRLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRILRQPVGRI
YFAGTETATEWSGYMEGAIQAGERAAREILFAMRKIPESEIWKPEPESIDVPALPITTTF
WERNLPSVPGLIKLIGFSTVFTSVAVAGLFAYKKGLLVRN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
aaccagttcctagcccaatttttaattgtttcttttctttcaggtctctcggcagccaaa
ctgctgactgagtcaggcttgaatgtggtgctgctggaagccaatgacagggttggggga
agaactttcaccgtaaggaataagcaagttaaatatgtggaccttggaggagcctatgtg
gggccaacacagaatcgtctcctgcggttgtctaaggagttgggaatagagacatataaa
gtgaatgaagttgagcacctgatacaccatgtcaagggtaagtcttaccccttcaaaggt
gcattccctcctctgtggaatcctttggcctacctggactacaacaacctgtggaggacc
atggatgaaatgggaaaggagattcctaatgaagctccatggaaggctccacatgcagaa
gaatgggacaaaatgactatgcaagatttcatagacaaaatttgctggacaaatgctgcc
aagagttttgcaactctgtttgtgaatgtggatgtcacttctgaaccccacgaggtctct
gccctctggtttttgtggtatgtgaagcagtgtggggggacagccaggatcttctcaaca
accaatggagggcaggagagaaagtttgttggaggctctggacagatcagtgagaaaata
atggagcgcctaggaagccgagtgaaactgaggaagccagtagttcgcattgaccagtcg
ggtgaaaacgtcgtagtggaaaccttagatcatgaattatatgagggcaaatatgtgatc
agtgccattcccccagctcttggtttgaagattcatttcaacccacctttgcccccaatg
agaaaccagctcatcaaccgaatcccaatgggctcagtcatcaaatgcatcgtgtactac
aaggaaaccttctggaggaagaaggggtattgtggtaccatgatgattgaggacgaggat
gctgcaattggtttaacacttgatgatactaagcctgatggtagctttcctgccataata
ggtttcattcttgctcgaaagtgtagaagactgacaaatctcacaaaagaagaaaggaaa
acgaggctgtgtgagctctatgcaaaggttctgggatcagaggaagctttacatccagta
cattatgaagagaagaactggtgtgaagagcagtattctggaggatgctacacagcctac
ttcccaccaggcataatgactcagtatggaaggattcttcggcagcccgttggcaggatc
tactttgctggcacagagacagccacagagtggagcggatacatggagggggccatacag
gctggagaaagagcagccagagagatactgtttgctatgaggaaaatcccagaaagtgaa
atatggaagccagaacctgaatcaattgatgttccagctttgcccatcactacaaccttt
tgggagaggaacttgccatctgtgccaggactgataaagctgattggattttccactgta
ttcacctctgtggctgtggcagggttatttgcctacaaaaaaggacttctggttcgaaac
tga

DBGET integrated database retrieval system