KEGG   Anas platyrhynchos (mallard): 101793000Help
Entry
101793000         CDS       T02816                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101793000 (MAOA)
   00330 Arginine and proline metabolism
    101793000 (MAOA)
   00340 Histidine metabolism
    101793000 (MAOA)
   00350 Tyrosine metabolism
    101793000 (MAOA)
   00360 Phenylalanine metabolism
    101793000 (MAOA)
   00380 Tryptophan metabolism
    101793000 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101793000 (MAOA)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101793000 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 552 aa AA seqDB search
MKSFRILSGVFENSIKISDHEGLVQFLSIVIDCCHLLYSTLSLFMVGLSAAKLLSESGLS
VVVLEARNRVGGRTFTIRNKHVGYVDVGGAYVGPTQNRILRLAKELGIETYKVNIDGYAI
HYRAGKSRHFVGIRPSTWNPFVYLDYNNFWRTLDKFGKEIPLEAPWDAPHAEEWDKMTMK
ELINKTCWTKAGKEFATLFVNVNVTSEPHEVSALWFLWYVRQCGGTSRIFSVTNGGQERK
FVGGSGQISEKIKDRLGGKVKLERPVVRIDQTGDNVIVETLNHEIYEGKYVISAIPPILT
TKIHYNPELPPKRNQLIQRMPMGSVIKCMMYYKEAFWEKKGCSAALFIEDEECPIGITMD
DTKPDGSFPAIMGFILTRKAVKLASLTKEERKKKICESYAKAMGMEEALHPVHYEEKNWT
MEQYSGGCYTAYFPPGIMYSYGRIIRQPVDRIYFAGTETATQWSGYMEGAVQAGERAARE
ILHRMGKISENEIWMPEPESKDVPSRPFTTTFWERNLPSAPGLLCLLGNTVFFTSVAAAG
LFAYKKGLLIRN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttcagaattctctcaggagtttttgaaaacagtattaaaatctctgaccat
gaaggtctggttcagtttttgagcattgtgattgattgctgccacttgctttatagcact
ctttctctttttatggtaggtttgtcggctgccaagttgctgtctgagtctgggctcagc
gtggtagttctcgaagcccggaacagagttggaggaaggacattcactattaggaataag
cacgtcggttatgtagatgttggtggagcgtatgtgggacctacccaaaataggattctc
cgcctggcaaaggagctgggtattgagacctataaagtgaatatagatggctatgccatc
cattacagggcgggaaagtcacgccacttcgtgggtattcgcccttcaacgtggaatccc
ttcgtttatctggattacaataatttctggaggaccctggacaaatttggaaaagagatt
cctcttgaagcaccatgggatgctccacatgcagaagagtgggacaaaatgaccatgaaa
gagctaataaataagacttgctggaccaaagctggtaaagaatttgccaccctctttgtg
aatgtcaacgtcacgtctgagccgcacgaagtctccgctctctggttcctgtggtacgtg
aggcaatgtgggggcacatccaggatattctctgtcaccaatgggggccaggagaggaag
tttgttgggggttctggtcagatatcagagaaaataaaggatcgcctcggaggcaaagtt
aaactggagagacctgtggtccgtattgatcagacaggtgataatgtcattgtggagact
ctaaaccatgaaatatatgagggcaagtatgtgatcagtgctatccctcctatcctgaca
acgaagatccattacaacccagaactgccaccaaagagaaaccagttaattcagcgtatg
cctatggggtctgtcataaaatgcatgatgtactacaaggaagccttctgggagaagaaa
ggttgcagtgctgctctcttcattgaagatgaagaatgcccaatcggaataaccatggat
gacacgaaaccagatggatcttttcctgccattatgggtttcatccttaccaggaaggct
gttaagctggccagtctcactaaggaagagaggaagaagaaaatctgcgagtcatatgcc
aaggcaatggggatggaagaggcattacatccagtgcattatgaagaaaagaactggacc
atggaacaatattcagggggttgctacacagcctacttcccacctggcataatgtattca
tacggaaggatcattcgccagccagttgacagaatctactttgctggcacggagacggct
acccaatggagcgggtacatggagggggccgtgcaggcaggagagagagcagccagagag
attttacaccgtatggggaagatctctgaaaatgaaatttggatgccagagccagagtca
aaggacgtcccatcccgaccatttaccaccaccttctgggagaggaacctgccgtctgcg
ccaggactgctctgtctgcttgggaatactgtttttttcacctctgtggctgctgcaggg
ctgtttgcctataaaaagggactattaattcgaaattag

DBGET integrated database retrieval system