KEGG   Anas platyrhynchos (mallard): 101793000Help
Entry
101793000         CDS       T02816                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:apla00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apla00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:apla00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:apla00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:apla00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:apla00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:apla00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 552 aa AA seqDB search
MKSFRILSGVFENSIKISDHEGLVQFLSIVIDCCHLLYSTLSLFMVGLSAAKLLSESGLS
VVVLEARNRVGGRTFTIRNKHVGYVDVGGAYVGPTQNRILRLAKELGIETYKVNIDGYAI
HYRAGKSRHFVGIRPSTWNPFVYLDYNNFWRTLDKFGKEIPLEAPWDAPHAEEWDKMTMK
ELINKTCWTKAGKEFATLFVNVNVTSEPHEVSALWFLWYVRQCGGTSRIFSVTNGGQERK
FVGGSGQISEKIKDRLGGKVKLERPVVRIDQTGDNVIVETLNHEIYEGKYVISAIPPILT
TKIHYNPELPPKRNQLIQRMPMGSVIKCMMYYKEAFWEKKGCSAALFIEDEECPIGITMD
DTKPDGSFPAIMGFILTRKAVKLASLTKEERKKKICESYAKAMGMEEALHPVHYEEKNWT
MEQYSGGCYTAYFPPGIMYSYGRIIRQPVDRIYFAGTETATQWSGYMEGAVQAGERAARE
ILHRMGKISENEIWMPEPESKDVPSRPFTTTFWERNLPSAPGLLCLLGNTVFFTSVAAAG
LFAYKKGLLIRN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttcagaattctctcaggagtttttgaaaacagtattaaaatctctgaccat
gaaggtctggttcagtttttgagcattgtgattgattgctgccacttgctttatagcact
ctttctctttttatggtaggtttgtcggctgccaagttgctgtctgagtctgggctcagc
gtggtagttctcgaagcccggaacagagttggaggaaggacattcactattaggaataag
cacgtcggttatgtagatgttggtggagcgtatgtgggacctacccaaaataggattctc
cgcctggcaaaggagctgggtattgagacctataaagtgaatatagatggctatgccatc
cattacagggcgggaaagtcacgccacttcgtgggtattcgcccttcaacgtggaatccc
ttcgtttatctggattacaataatttctggaggaccctggacaaatttggaaaagagatt
cctcttgaagcaccatgggatgctccacatgcagaagagtgggacaaaatgaccatgaaa
gagctaataaataagacttgctggaccaaagctggtaaagaatttgccaccctctttgtg
aatgtcaacgtcacgtctgagccgcacgaagtctccgctctctggttcctgtggtacgtg
aggcaatgtgggggcacatccaggatattctctgtcaccaatgggggccaggagaggaag
tttgttgggggttctggtcagatatcagagaaaataaaggatcgcctcggaggcaaagtt
aaactggagagacctgtggtccgtattgatcagacaggtgataatgtcattgtggagact
ctaaaccatgaaatatatgagggcaagtatgtgatcagtgctatccctcctatcctgaca
acgaagatccattacaacccagaactgccaccaaagagaaaccagttaattcagcgtatg
cctatggggtctgtcataaaatgcatgatgtactacaaggaagccttctgggagaagaaa
ggttgcagtgctgctctcttcattgaagatgaagaatgcccaatcggaataaccatggat
gacacgaaaccagatggatcttttcctgccattatgggtttcatccttaccaggaaggct
gttaagctggccagtctcactaaggaagagaggaagaagaaaatctgcgagtcatatgcc
aaggcaatggggatggaagaggcattacatccagtgcattatgaagaaaagaactggacc
atggaacaatattcagggggttgctacacagcctacttcccacctggcataatgtattca
tacggaaggatcattcgccagccagttgacagaatctactttgctggcacggagacggct
acccaatggagcgggtacatggagggggccgtgcaggcaggagagagagcagccagagag
attttacaccgtatggggaagatctctgaaaatgaaatttggatgccagagccagagtca
aaggacgtcccatcccgaccatttaccaccaccttctgggagaggaacctgccgtctgcg
ccaggactgctctgtctgcttgggaatactgtttttttcacctctgtggctgctgcaggg
ctgtttgcctataaaaagggactattaattcgaaattag

DBGET integrated database retrieval system