KEGG   Anas platyrhynchos (mallard): 101793110Help
Entry
101793110         CDS       T02816                                 

Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00511  Other glycan degradation
apla00600  Sphingolipid metabolism
apla01100  Metabolic pathways
apla04142  Lysosome
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101793110
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101793110
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101793110
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101793110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C DUF229
Motif
Other DBs
NCBI-GeneID: 101793110
NCBI-ProteinID: XP_005022871
Ensembl: ENSAPLG00000011544
Position
Un
AA seq 522 aa AA seqDB search
MWAQRAGVLGWLLLLQAVPRAAGARPCSPKYFGRDSMVCVCNATYCDTLDPVVLPAPGTF
VKYESSKAGKRLERSEGSFQRSLRAPDLVLTVDTTQRYQKIKGFGGSVTDSAAINILSLP
EKAQDHLLRSYFSEEGLEYNLVRIPMASCDFSLHAYTYDDVPYDYELTHFSLRDEDTKLK
IPILHRASAMAKRPLSLYASPWTSPAWMKTSESFIGKGTLKGQAGDKYHKTWANYFVRFL
DEYAKHNLTFWAVTAENEPSAGLINNYPFQCLGFTAEQQRDFIARDLGPALANSSHRNVQ
LIILDDNRLHLPHWAKVVLKDPVAASYISGIGIHWYLDFIGPIQDTVVPTHELFPDYFIL
ATEACIGAHFWERDVILGCWERGNQYSHSILTNLNHFVAGWTDWNLALDLEGGPNWVKNY
VDSPVIVDSSKDVFYKQPMFYHMGHFSKFIPEGSQRVGLVASKESKKTDLEYSAFVRPDG
AVVVVVLNRSLQNVTFGLADTVGLIEAVAPASSIQTYLWRRQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcccagcgtgccggggtcctgggctggctgctgctgctccaggcggtgcccagg
gctgcaggcgcccggccctgcagccccaagtactttggccgtgactccatggtgtgcgtg
tgcaatgccacgtactgcgacacgctggaccccgtggtgctgccggccccgggcaccttc
gtcaagtacgagagcagcaaggccggcaagcggctggagcgcagcgaggggagcttccag
cgcagcctccgggccccagatctcgtcctgactgtggacacgacgcagcgataccagaag
ataaagggattcggtggctctgtcactgactcggctgccataaacatcctttccctgccc
gagaaagcccaggaccacctgctgcgctcctatttctctgaggaagggcttgagtacaac
ctcgtccgcatccccatggccagctgcgacttctccctgcacgcctacacctacgatgat
gtcccctatgactacgagctcacccacttcagcctgcgggatgaggacacgaagctgaag
atccccatcctgcaccgagcctcggccatggccaaacggccgctgtccctgtacgcgagt
ccctggacctctccagcctggatgaagaccagcgagtccttcatcgggaagggcacgctg
aaggggcaggcgggggacaagtaccacaagacctgggccaactacttcgtgcgctttctg
gacgaatacgccaagcacaacctgaccttctgggcggtgacggccgagaacgagccctca
gctgggctgatcaacaactaccccttccagtgcctgggcttcacggccgagcagcagcgg
gacttcatcgcgcgggacctgggccctgcgctggccaacagctcccaccgcaacgtccag
ctcatcatcctggatgacaaccgcctccacctcccacactgggccaaagtggttctcaaa
gaccccgtggccgccagctacatcagcggcatcggcatccactggtacctggacttcatc
ggccccatacaggacaccgtggtgcccactcacgagctcttcccagattacttcatcctg
gccacggaggcgtgcatcggggcccacttctgggagcgggatgttatcctgggctgctgg
gagcgggggaaccagtacagccacagcatcctgacgaacctgaaccacttcgtggccggc
tggaccgactggaacctggcgctggacctggaggggggtcctaactgggtcaagaactac
gtggacagccccgtcatcgtggacagcagcaaggacgtcttctacaagcagcccatgttc
taccacatggggcacttcagtaagttcatcccagagggctcccagcgtgtggggctcgtc
gcctccaaagagtccaagaagaccgacctggagtactcggccttcgtgcgccccgacggt
gcggtggtggtggtggtcctcaacaggtccctgcaaaatgtgaccttcgggctggccgac
acggtcggcctcatcgaggccgtggctccggccagctccatccagacctacctgtggcgg
cggcagtga

DBGET integrated database retrieval system