KEGG   Anas platyrhynchos (mallard): 101793769Help
Entry
101793769         CDS       T02816                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101793769 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 342 aa AA seqDB search
MAPGLPLPVPTILLARSAELLAVSLHSPGGFSSQIFDPPEEVERKVRELADLIRSSSNVV
FHTGAGISTASGIPDFRGPNGVWTMEEKGLSPKFDTTFENARPSKTHMALLGLQRVGILK
FLVSQNVDGLHVRSGFPRYYPLLPASRSLVPVPSACGSCLAQPHVQTFADRKQQFKGNPG
PRVSSRGKLRDTILDWEDSLPDRDLTLADEACRKADLSVTLGTSLQIKPSGNLPLITKKR
GGKLVIVNLQATKHDKQADLRIHAYVDDVMTKLMKHLGLEVPLFKFEPEARGLLKEESFA
QCNGTAGLCPDLGTTLVEXXDSLQQDTGPPPPKKVKVEPLLT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccccaggactccctctgccagtgcccaccatcctgctggcgcgcagcgcggagctc
ctggctgtgtctctccattcccctggtggtttctcttctcagatctttgacccgccggag
gaggtggagaggaaggtgcgtgagctggcggatttgatcaggagctcctccaacgtggtg
ttccacaccggggccgggatcagcaccgcctcggggatccccgacttcagggggcccaat
ggcgtctggactatggaagagaaggggctctccccaaagttcgacaccaccttcgagaac
gccaggccctccaagactcacatggcgctgctggggctgcagagggtcggcatcctgaaa
ttcctggtcagccaaaatgtggacggccttcacgtgcggtcgggattcccacggtactac
cccctcctccctgcctccaggtccctcgtgcctgtcccctctgcgtgcggttcgtgctta
gcacagcctcacgtgcaaacgtttgcagacagaaagcaacagtttaagggtaaccccggt
ccccgtgtgtcttctagagggaagctacgagacacgattctggactgggaggattccctt
cccgaccgtgacctcacgctggcggacgaagcctgcaggaaagccgacctctctgtcacg
ctggggacctccctgcagatcaaacccagcggcaacctcccgctgatcacgaagaagaga
ggagggaagctcgtcatcgtcaacctgcaagccaccaagcacgacaaacaggccgacctg
cgcatccacgcctacgtcgacgatgtcatgaccaagctgatgaagcacctggggctggag
gtcccgctcttcaaatttgagcccgaggcacgcgggctgctcaaggaggaatccttcgcc
cagtgcaacggcacggccgggctgtgccccgacctcgggaccacgctggtggagnnnnnn
gacagcctgcagcaggacacggggccgccgccgccgaagaaggtgaaggtggagcctctc
ctcacctga

DBGET integrated database retrieval system