KEGG   Anas platyrhynchos (mallard): 101794100Help
Entry
101794100         CDS       T02816                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101794100
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     101794100
Cytochrome P450 [BR:apla00199]
 Cytochrome P450, animal type
  CYP21 family
   101794100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 349 aa AA seqDB search
MGSPPLYHSWDLRSYGGAPIDVFEAFAFHTCSTICLLVFGDLMPPEAEVRAFTHCVMELL
EVWGRASVRVLDLLPLLRVLPNPGLRRLLSLVESRDAFVEAQIRRHKVTRVPLQACASPP
EDTVLGALLGEDPSVRGGPLGPDRLHMALVDLFIGGTETTAAALAWAVAFLLHRPEVQER
VRAELHQELGPTGTPQVGDMGRLPLLRATITETLRLRPPAPLALPHCTRRHTSVGGVPVP
AGSIVIPNLFAAHHDPETWHRPDEFLPERFLEPGAPWRALVPFGCGARSCLGEALARAEL
FVFLGHILHHFRLEPPVPGALPKLGVTAGTVLRCPPFCVRLVPCQPPTP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggatcccctcccctctaccactcttgggacctgcgttcttatgggggggcgcccatt
gatgtcttcgaggcattcgccttccacacctgcagcaccatctgcctcctcgtctttggg
gacctgatgccccccgaggctgaagtccgggccttcacccactgcgtcatggagctgctg
gaggtgtggggcagggccagcgtccgggtgctcgacctgctgccactgctgcgggtgctg
cccaacccagggctgcggcggctgcttagcctggtggagtcccgtgacgccttcgtggag
gcccagatccggcgtcacaaggtgacacgtgtccccttgcaggcctgcgcctcgccccct
gaggacacagtgctgggggcgctgctgggggaggaccccagtgttcggggggggccgcta
ggccccgatcggctgcacatggccctggtcgacctcttcatcggtggcactgagacgaca
gcagctgccctggcctgggccgtggccttcctgctgcatcgccctgaggtgcaggagcgg
gtgcgtgcagagctgcatcaggagctgggccccacaggcaccccccaggtgggggacatg
ggacgcctgcccctgctccgcgccaccatcaccgagaccctgcgcctgcggccacctgca
cccctggccctgccccactgcacacgccgccacaccagtgttgggggtgtccctgtgcca
gctggctccatcgtcatccccaacctcttcgctgcccaccacgaccctgagacctggcat
cgccctgacgaattcctgccagagcggttcctggagccaggggcaccttggcgagcgctg
gtacctttcggttgcggggcccgatcctgcctgggtgaggcattggcacgagctgagctc
tttgttttcctgggccacatccttcatcatttccgcctggagccaccggtgcctggtgcc
ctgcccaagctgggggtgacagctggcaccgtcctgcgctgccccccattctgcgtgcgc
cttgtgccctgtcagccccccaccccctga

DBGET integrated database retrieval system