KEGG   Anas platyrhynchos (mallard): 101794100Help
Entry
101794100         CDS       T02816                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101794100
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     101794100
Cytochrome P450 [BR:apla00199]
 Cytochrome P450, animal type
  CYP21 family
   101794100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 347 aa AA seqDB search
MSPQPPVVTPFFPPQDLRSYGGAPIDVFEAFAFHTCSTICLLVFGDLMPPEAEVRAFTHC
VMELLEVWGRASVRVLDLLPLLRVLPNPGLRRLLSLVESRDAFVEAQIRRHKACASPPED
TVLGALLGEDPSVRGGPLGPDRLHMALVDLFIGGTETTAAALAWAVAFLLHRPEVQERVR
AELHQELGPTGTPQVGDMGRLPLLRATITETLRLRPPAPLALPHCTRRHTSVGGVPVPAG
SIVIPNLFAAHHDPETWHRPDEFLPERFLEPGAPWRALVPFGCGARSCLGEALARAELFV
FLGHILHHFRLEPPVPGALPKLGVTAGTVLRCPPFCVRLVPCQPPTP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtccccccagccccccgtggtgaccccctttttccccccccaggacctgcgttcttat
gggggggcgcccattgatgtcttcgaggcattcgccttccacacctgcagcaccatctgc
ctcctcgtctttggggacctgatgccccccgaggctgaagtccgggccttcacccactgc
gtcatggagctgctggaggtgtggggcagggccagcgtccgggtgctcgacctgctgcca
ctgctgcgggtgctgcccaacccagggctgcggcggctgcttagcctggtggagtcccgt
gacgccttcgtggaggcccagatccggcgtcacaaggcctgcgcctcgccccctgaggac
acagtgctgggggcgctgctgggggaggaccccagtgttcggggggggccgctaggcccc
gatcggctgcacatggccctggtcgacctcttcatcggtggcactgagacgacagcagct
gccctggcctgggccgtggccttcctgctgcatcgccctgaggtgcaggagcgggtgcgt
gcagagctgcatcaggagctgggccccacaggcaccccccaggtgggggacatgggacgc
ctgcccctgctccgcgccaccatcaccgagaccctgcgcctgcggccacctgcacccctg
gccctgccccactgcacacgccgccacaccagtgttgggggtgtccctgtgccagctggc
tccatcgtcatccccaacctcttcgctgcccaccacgaccctgagacctggcatcgccct
gacgaattcctgccagagcggttcctggagccaggggcaccttggcgagcgctggtacct
ttcggttgcggggcccgatcctgcctgggtgaggcattggcacgagctgagctctttgtt
ttcctgggccacatccttcatcatttccgcctggagccaccggtgcctggtgccctgccc
aagctgggggtgacagctggcaccgtcctgcgctgccccccattctgcgtgcgccttgtg
ccctgtcagccccccaccccctga

DBGET integrated database retrieval system