KEGG   Anas platyrhynchos (mallard): 101794412Help
Entry
101794412         CDS       T02816                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101794412 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 652 aa AA seqDB search
MAQQRRVHLCTQRPTSTVCVLGTELSLDVLGSAPKDAVAFHVQGTPGVKVYVVHETQSVK
LPSSVGRWPLAPSTEVLVTMEALSKDVGDEKVRISYFGEASGVPVGRAMLYLTCVDISLD
ADTSRSGSVGRTLVDKATWTWGPDGHGAILLVNCDRDDPKSGVMDNSDTAVRSYEDLKDM
SQMVLRTRGPRTIFTGHRLVLHVDFGEADKVGVFYGGXVSAGTRYKHVLGGQKLAYAVKP
SRHQEESIFFVEGLSFPDASFSGLVSFHVTLLESPEKGLLEMPIFTDTVVFRVAPWIMTP
NTLAPLEVFVCSVEDNEDFVAAVSALAEEAKCPVTICPLLENRNDRWIQDEVEFGYVQAP
HKTFPVVFDSPRDRGLKDFPVKSILGPDFGYVARDVQKDASSLDSFGNLDVSPPVTVRGK
EYPLGRILIGSSFPRFGGRRMARAVRDFLFAQRVQAPVELYSDWLHVGHVDEFLSFVPAP
DRKGFRLLLASPSACYQLFKEKQEQGFGEAAMFQGLQAVPKPTINEILANEALRKFNSYV
QVRKGSGVAEQDIIDIPQLFQGNEQAHANAFFPDMVNMLVLGRHLGIPKPFGPLVAGQCC
LEEHVRALLEPLGLSCTFINDYYSYHVLSGEVHCGTNVRRKPFAFKWWRMVL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagcgccgtgtccacctctgcacccagcgccccaccagcaccgtctgcgtg
ctgggcaccgagctctccctcgacgtcctggggtcggcgcccaaagatgccgttgccttc
cacgtgcaggggacgccgggcgtgaaggtctacgtggtgcacgagacgcagagcgtgaag
ctgccctccagcgtcggccgctggcccctggcccccagcaccgaggtgctggtgaccatg
gaggcgctcagcaaagatgttggtgatgaaaaggtcaggatttcctattttggggaggcc
agcggggtgccggtgggcagagccatgctgtacctcacctgcgtggacatctcactggac
gccgacaccagccgcagcgggtcggtgggcaggacgctggtggacaaggccacatggacg
tggggtcccgacgggcacggcgccatcctgctggtgaactgtgaccgcgacgaccccaag
agcggggtgatggataacagcgacaccgccgtgcgctcctacgaggacctgaaggacatg
tcgcagatggtgctgcgcacacgtggtccccgcaccatcttcaccggccaccgccttgtc
ctccacgtggatttcggggaggctgacaaagtcggcgttttctacggcggnnnagtgagt
gccggcaccaggtacaagcatgtgctggggggtcagaagctcgcctacgccgtgaagccc
agccggcaccaggaggagagcatcttcttcgtggaggggctctccttccccgacgccagc
ttttcggggctggtgtccttccacgtcacgctgctggagagccccgagaagggcttgctg
gagatgccgatcttcacggacacggtggttttccgcgtggctccttggatcatgacgccc
aacaccctggcgccgctggaggtcttcgtgtgcagcgtggaggacaacgaggacttcgtg
gcggccgtcagtgccctggccgaggaagccaagtgccccgtgaccatctgcccactgctg
gagaaccgcaacgaccgctggatccaggatgaggttgaatttggctatgtgcaagccccc
cataagacgttccctgtggtcttcgactcaccccgtgaccgagggctgaaggatttcccc
gtcaagagcatcctgggccctgatttcgggtacgtggctcgggacgtgcagaaggacgcc
tccagcctcgactccttcggcaacctggatgtgagcccgccagtgacggtgcggggcaag
gagtaccccctgggccgcatcctgatcggcagcagcttccccaggtttggtggccggcgg
atggccagggccgtgcgggatttcctcttcgcgcagcgggtgcaagcacccgtggagctc
tactccgactggctccacgtcgggcacgtcgatgaattcctcagcttcgtccctgcccct
gatcggaagggttttcggctgctcctggccagccccagcgcctgctaccaactcttcaag
gagaagcaggagcaaggttttggggaggcagcgatgtttcaggggctgcaggcggtgccc
aagccaaccatcaacgagatcctggctaacgaagcgctccggaaattcaacagctacgtg
caggtgaggaaggggagcggggtggccgagcaggacatcatcgacatcccccagctcttc
caaggcaacgagcaagcccacgccaacgcgtttttccctgacatggtgaacatgctggtg
ctgggcaggcacctgggcatccccaagccttttgggccactggtggccgggcagtgctgc
ctggaggagcatgtgcgggcgctgctcgagcccctggggctctcctgcaccttcatcaac
gactactactcctaccacgtcctctccggagaggtccactgcggcaccaacgtccgccgc
aagcccttcgccttcaagtggtggcgcatggtgctctga

DBGET integrated database retrieval system