KEGG   Anas platyrhynchos (mallard): 101794588Help
Entry
101794588         CDS       T02816                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
apla  Anas platyrhynchos (mallard)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 657 aa AA seqDB search
MPQRQVVKMSTSRASYGVCVLGTEVFLDTHRSTPKGATSFDVHATSAVTVHIIHNPMTKP
MFNSRWPLDPDIEVVVTIDVTSKTVNDNKVKISYYGREENELSVAWLYLTCVDISLDVDV
SRNGRVRSKGKDKAKWTWGPDGQGAVLLVNCDRDSPGAVGTDSGQVDIRTNADLQDMSVM
LLRTQGPSNIFAEYQLVLHVPESDADKVRVFHAIRSDSHPQYKPVLGPGKLSYVLDRVGS
GENTFYVEGLAFPDAGFSGLVSFSVSLLEYSPGTPIFTDTVVFRMAPWIMTPNTQQPLEV
FVCSIKRGINSNDVFLEQLQALLRKANCKLTICSEVESRSDRWIQDELEFGYVEAPHKTF
PVVFDSPRNRGLKDFAFKKILGPDFGYVTREPPGQEASSLDSFGNLDVSPPVTVRGKEYP
LGRILIGSPLPWASGRRMSKVVRDFLYAQKVQAPVEIYSEWLSVGHVDEFLTFVPAYDRK
GFRLLLASPTACYKLFQEKQRQGHGEATQLVGMSGTERRSIDDILADEGLRNDNRHVQRC
IDWNRDLLKQELGLSEQDIIDIPQLFILNGSRADAYFPDMVNMLVLGRHLGIPKPFGPLV
AGQCCLEEHVRALLEPLGLSCTFINDYYSYHVLSGEVHCGTNVRRKPLAAKWWHVVP
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgccccaacgccaggtcgtgaagatgtccaccagccgcgccagctacggcgtctgcgtg
ctgggcaccgaggtcttccttgacacccaccgatctactcccaaaggtgccacgtcattt
gatgtccatgccacctctgcagttacggtccacatcatccacaaccccatgacaaaaccc
atgtttaactccagatggccactggatcctgatatagaggttgtagtgaccatcgatgtc
accagcaagaccgtcaacgacaataaggttaagatttcatactacggacgggaagagaat
gagctttcggtggcttggttgtatctcacctgcgtagacatatccctggacgtggatgtg
agccgtaatggcagagtgaggagcaaagggaaggacaaggccaagtggacgtggggtccg
gatgggcaaggtgctgtgctgctggtcaactgtgacagggacagccccggcgcggtgggg
acagacagcggccaggtggacatacggaccaatgcagacctccaagacatgtccgtgatg
ctgctgcggactcaaggtcccagcaatatctttgctgagtaccagctggtcctgcacgtc
cccgagtcggacgcagacaaagtgcgtgttttccatgccatacggagtgactcacacccc
cagtacaaacccgtgctggggccgggtaagctctcctatgtgctagaccgtgtcggcagc
ggagaaaacaccttctacgtggaagggttggctttccctgatgcgggcttctccgggttg
gtttccttcagcgtcagcttactggagtattcaccgggcaccccgattttcacggataca
gtggttttccgcatggcaccctggataatgacgcccaacacccagcagcctctggaggtt
tttgtctgcagcatcaagaggggcataaactccaacgatgtctttctggagcagctccag
gccctgttgaggaaagccaactgcaagctgaccatctgctcagaggtcgagagccggagt
gaccgctggatccaggatgagctggagtttggctacgtggaagcaccacacaagaccttc
cccgtggtcttcgactcacccaggaacagaggcttgaaggactttgcttttaaaaagatc
ctgggccccgattttggctacgtgacccgcgagccccctggacaagaggcctccagcctc
gactccttcggcaacctggatgtgagcccgccagtgacggtgcggggcaaggagtacccc
ctgggccgcatcctgatcggcagccccctgccctgggcctccggccggcggatgtcgaag
gtggtcagggatttcctttacgcccagaaggtgcaagccccggtggagatctactcggag
tggctgagtgtgggccacgtggacgagttcctcacctttgtccccgcatacgacaggaag
ggtttccggctcctgttggccagccccaccgcctgctacaagctcttccaggagaagcag
aggcagggccatggcgaagccacacagctcgtggggatgtcgggcaccgagcggaggagc
atcgatgacatcctggcggatgaggggctgaggaatgacaacaggcacgtgcagcgctgc
atcgactggaaccgcgacctcctgaagcaggagctggggctgagcgagcaggacatcatc
gacatcccccagctcttcatcctgaacggctcccgcgcggacgcctacttcccagacatg
gtgaacatgctggtgctgggcaggcacctgggcatccccaagccttttgggccactggtg
gccgggcagtgctgcctggaggagcatgtgcgggcgctgctcgagcccctggggctctcc
tgcaccttcatcaacgactactactcctaccacgtcctctccggagaggtccactgcggc
accaacgtccgccgcaagcccctagccgccaagtggtggcacgtggtgccctga

DBGET integrated database retrieval system