KEGG   Anas platyrhynchos (mallard): 101794647Help
Entry
101794647         CDS       T02816                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101794647
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101794647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 115 aa AA seqDB search
PITGSQYYGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWGFAPSDRALVFVDNHD
NQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWTRNFVNGKVSL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
ccaatcacaggcagtcagtactacggaaatggccgagtgaccgaattcaaatatggcgca
aaactggggacagtgatccgcaagtggaatggagagaagatggcctacttaaagaactgg
ggagaaggctggggctttgcgccttctgacagagccctggtctttgtggataaccatgac
aaccagcgggggcacggggctggtggagcttccattctcaccttctgggacgccaggctt
tataaaatggctgttggtttcatgttggctcatccgtatggattcacacgtgtgatgtca
agttatcgttggacaagaaattttgtaaatgggaaggtaagtttgtaa

DBGET integrated database retrieval system