KEGG   Anas platyrhynchos (mallard): 101795502Help
Entry
101795502         CDS       T02816                                 

Definition
protein-glutamine gamma-glutamyltransferase K-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101795502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 82 aa AA seqDB search
MRPMERLNTDSVWNFHVWNDCWMKRPDLPDGYDGWQVVDATPQETSSGLFCCGPCSVTAV
KNGEVFLKYDTPFVFAEVGGVA
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccatggagcgcctcaacaccgactccgtctggaacttccacgtgtggaacgac
tgctggatgaagcgccccgacctccccgatggctatgacgggtggcaggtggtcgatgcc
accccgcaggagaccagcagcgggctcttctgctgcgggccctgctcggtgacggcggtg
aagaacggcgaggtcttcctcaagtacgacacgccgttcgtctttgctgaggtagggggc
gtggcttaa

DBGET integrated database retrieval system