KEGG   Anas platyrhynchos (mallard): 101796205Help
Entry
101796205         CDS       T02816                                 

Definition
histone acetyltransferase KAT8-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101796205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 248 aa AA seqDB search
FLSLTGPSPKLVPVPYWSQCRSLTGPSAQLVPVPISYWFPADSAEVIQSRLNEQEAREEF
YVHYVGFNRRLDEWVDRNRLALSKTLKEAVQKSAEQFLGDLPEQPERKITRNQKRKHDEI
NHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGHFEIDAWYFSPFPEDYGKQPKLWI
CEYCLKYMKYERTYRLHLGQCQWRQPPGREIYRKSNISVYEVDGKDHKVRGVARGDMSRH
VVSYRDIS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttcctttctctaactggtcccagtcccaaactggtcccagtcccttactggtcccagtgc
cgctcccttactggtcccagtgcccaactggtcccagtaccgatctcttactggtttccc
gcagactcggcggaggtgatccagtcccggctcaacgagcaggaggcgcgggaggagttc
tacgtgcactacgtgggctttaaccggcggctggacgagtgggtggaccgcaaccggctg
gcgctgagcaagacgctgaaggaggcggtgcagaagagcgccgagcagttcctgggcgac
ctccccgagcagcccgagcgcaaaatcacccgcaaccagaaacgaaagcacgatgagatc
aaccacgtgcagaagacctacgccgagatggatcccaccacggccgcgctggagaaggaa
cacgaggcgatcacgaaggtgaaatacgtggacaaaatccacatcgggcacttcgagatc
gacgcctggtacttctcgcccttccccgaggactacgggaagcagcccaagctctggatc
tgcgagtactgcctcaagtacatgaagtacgagcgcacctaccgcctgcacctgggccag
tgccagtggcggcagccgccgggccgcgagatctaccgcaagagcaacatctccgtgtac
gaggtggacggcaaggaccacaaggtgcggggcgtggcacgcggggacatgtcgcgacat
gtcgtgtcatatcgtgacatatcgtga

DBGET integrated database retrieval system